KEGG   Drosophila simulans: Dsim_GD20515Help
Entry
Dsim_GD20515      CDS       T01065                                 

Gene name
Dsim_Ace
Definition
Acetylcholine esterase
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dsi  Drosophila simulans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsim_GD20515 (Dsim_Ace)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dsim_GD20515 (Dsim_Ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 657 aa AA seqDB search
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSGPVRGRSVTVQ
GREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEI
WNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLP
ILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEA
PGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHKTSEKAVEIGKALINDCNCNASMLKHITLLGSKPIPLNVMSCMRSVDAK
TISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLY
DFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRA
VGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNN
SLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARG
PLAARCSFWNDYLPKVRSWAGTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcctgtcggcagagcagagtcctgcccatgtccttgcccctgcccctggcc
atcccgctgcccctggtgctggtgctatcgctgcacctgtccggcgtctgcggcgtcatc
gatcgcctggtcgtgcagacatcctccggacccgtgcgcggtcgctccgtgacggtgcag
ggcagggaggtgcatgtttacacgggcattccctacgccaagccgcccgtcgaggacctg
cgcttccgaaagccggttcccgcggagccctggcacggcgtcctcgacgccacacggtta
tccgccacctgcgtccaggagcgttacgagtacttccccggcttctccggcgaggagatc
tggaaccccaacaccaacgtgtccgaggactgcctctacataaatgtctgggcgccggca
aaggcccgacttcgccatgggcggggtgccaacgggggcgagcaccccaatggcaaacag
gcggacactgaccatctcatccacaacggaaatccgcagaacacgaccaacggactgccg
attctgatctggatctatggcggtggcttcatgaccggatcggccaccctggacatctac
aatgcggatatcatggccgccgtgggcaatgtgatagtggcctccttccagtatcgagtt
ggcgcatttgggttcctgcacctggcgccggaaatgccgtcggagttcgcggaagaggcg
cccggcaatgtgggcctatgggatcaggcactcgccattcgttggctaaaggacaacgcc
catgctttcggcggaaatccggagtggatgaccctgttcggggagtcggctggatccagt
tcggtgaatgcccagctcatgtcgccggtgaccaggggcctggtcaagcggggaatgatg
cagtcgggcaccatgaacgccccctggagccacaagacctccgagaaggccgtggagatc
ggcaaggcgctgatcaacgactgcaactgcaatgcatccatgctgaagcatattacactg
ttgggtagtaaaccaatcccgctcaacgtgatgagctgcatgcgttccgtggacgccaag
accatatcggtgcagcagtggaactcctactcgggcatcctcagcttcccctcggcgccc
accattgatggtgcgttcctgccggcggatcccatgacgctgatgaagacggcggatctg
aaggactacgacatcctgatgggaaatgtcagggatgagggcacttacttcttgctgtac
gatttcatcgattacttcgataaggacgatgccacggccctgccacgggacaaatacctg
gaaattatgaacaacattttcggcaaggcaacgcaagcggaacgcgaggccatcattttc
cagtataccagttgggaaggcaatcctggctatcagaaccagcagcaaatcggacgcgcc
gtgggcgatcacttcttcacctgccccaccaacgagtatgcccaggctctggcggagcga
ggcgcctccgtgcattactactactttacacaccgcacaagcacctcgttgtggggcgaa
tggatgggcgtgctgcacggcgatgagatcgagtacttctttggccagccgctgaacaac
tccctgcagtatcgacctgtggagcgtgagctgggcaagcgtatgctcagtgcggtcatc
gagtttgccaagacgggaaatcccgctcaggatggcgaggagtggcccaacttctcgaag
gaggatcccgtctactatattttcagcaccgacgataagatcgagaaattggccaggggt
cctttggcggctcgctgctcgttctggaacgattacttgccaaaagtcaggagttgggca
ggtacttgcgatggcgattcgggaagtgcttccatatccccgaggctccagctccttgga
atcgctgctctgatctacatctgcgccgcattgcgaaccaaaagggttttctaa

DBGET integrated database retrieval system