KEGG   Drosophila simulans: Dsimw501_GD20543Help
Entry
Dsimw501_GD20543  CDS       T01065                                 

Gene name
Dsim_GD20543
Definition
(RefSeq) GD20543 gene product from transcript GD20543-RB (EC:2.4.1.-)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD20543 (Dsim_GD20543)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD20543 (Dsim_GD20543)
   00500 Starch and sucrose metabolism
    Dsimw501_GD20543 (Dsim_GD20543)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsimw501_GD20543 (Dsim_GD20543)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD20543 (Dsim_GD20543)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD20543 (Dsim_GD20543)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD20543 (Dsim_GD20543)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD20543 (Dsim_GD20543)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsimw501_GD20543 (Dsim_GD20543)
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsimw501_GD20543 (Dsim_GD20543)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 530 aa AA seqDB search
MVLPAEKILLLAIAIGALMGSSQGANILGLFTSISPSHLIIQMSAVKVLAENGHNVTVVT
VLKPVVNHKNITVIQVPLSREEAQIMSDKIGVMSKNDNSNMALSLLRMSEQMDFMIRKNA
ETLMNDRVRDLYLNRGNKFDLVISGYFINDFQLGFARKVNAPVIVLATMPPNQLLNPLIG
NPLEVSYAGITNPLEGSNAVTFQLRLANYMQSVVFRVVSHLAERRNRNWYKKVYGNDPNM
PEYSEMLKNTSLVFFSSHAASEGPIRPNVPSAIEIGGIQIKDKPDPLPQTIAEFLGNATN
GAILLSLGSNVQGKHLNPETVVKMFNVLSKLKERVIWKWEDQENTPGKSANILYSKWLPQ
DDILAHPNIKLFINHAGKGGITESQYHGKPMLSLPVFGDQPRNANAMVKSGFGLTLSLLT
LEEQPFQEAILEILSNPQYAERVKSFSTLYRDRPMTARQSFLYWTEYVIRHHGAAHLQSP
LLHMNFIAANNIDIYFLIFVILISVLVLIKFLVKFIYRRFISKPKKVKTN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggttctccctgcggaaaaaattctgctgctagcgatagctattggcgcccttatgggc
agctcccagggagctaatattctgggcctcttcacgagcatcagtccctcgcacttgatc
atccaaatgtccgcggtcaaagtcctggccgagaatgggcacaatgtgacggtggtcacc
gtgctgaagccagtggttaaccataaaaacataaccgttatccaagtgccgcttagtcgg
gaagaagctcagataatgagcgataagattggagtgatgtccaagaacgacaatagcaac
atggctttatccctgctccggatgtcggaacaaatggacttcatgataagaaagaatgcc
gagaccctgatgaacgatcgagtgagggacctgtacctgaaccgtggaaacaagttcgac
ctggttatctctggatactttataaacgatttccagctcggattcgcaaggaaagtgaac
gcacccgtcatcgtattggccacaatgcctcccaatcaactattgaaccctctgattggt
aatccactggaggtttcctatgccggaatcactaatccattagagggcagtaatgccgta
acctttcaactgcgtttagccaactatatgcaaagcgtcgttttccgtgtggtttctcat
cttgccgagaggcgtaatcggaattggtacaagaaagtttatggcaacgatcccaacatg
cctgagtactcggaaatgctcaagaacacgtcgttggttttctttagttcgcacgcggcc
agtgaaggacccattaggcctaatgtcccttctgccatagaaatcggtggtattcagatt
aaggacaagccggatcccctaccccaaaccattgcggagtttctgggcaatgctacaaat
ggagctattctcctctccctgggttctaatgtccagggaaagcatcttaacccggaaaca
gttgtcaagatgttcaacgtcctttcaaaactaaaagaaagggttatttggaagtgggag
gaccaggaaaatacgccagggaaatcagctaatattctctactcgaagtggcttccgcag
gacgatatcctggcccacccaaacatcaagctattcatcaaccacgccggaaaaggtggc
attactgagtctcagtaccatggaaagcccatgctctcgctgccagtctttggtgaccag
ccacgcaacgcaaacgccatggtcaaaagcggttttggcctcactctgagcctgctcact
ttggaggaacagccgtttcaagaggccatcctggagatcttgtctaatccgcagtatgca
gaaagggttaagtccttttcaactctctaccgcgatcgcccgatgaccgctaggcaatca
ttcctctactggactgagtacgtcatccggcaccatggagctgcccatcttcagagtcct
ctgctgcacatgaacttcattgccgccaataatatcgatatttatttcctgatatttgtc
atactaatttccgttttggtacttattaagtttctggtgaagtttatttatagaaggttc
atctcgaagccaaagaaggtaaaaaccaattga

DBGET integrated database retrieval system