KEGG   Drosophila simulans: Dsim_GD20588Help
Entry
Dsim_GD20588      CDS       T01065                                 

Definition
GD20588 gene product from transcript GD20588-RA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dsi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dsi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsi00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dsi00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 341 aa AA seqDB search
MLALARSSWCGQLLCRVANIEARCPFSKSSTGGKQAEKKGKYRIVMVRHGESEWNQKNLF
CGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQDTLRAALKSSEHKKIPVC
TTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRY
KDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECIS
DKDIMSLNLPTGIPFVYELDENLKPLATLKFLGDPETVKKAMESVANQWQSQVIRDFQVS
PAASEEGQSNQLLVIVCQTKAANRKWCSLWPGECQAANKFI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttggctctggccaggagttcgtggtgtggccaattgctgtgtcgcgtggcgaacatc
gaagcccgctgcccgttctcgaagtcatcaaccggcggaaagcaggccgagaagaagggc
aagtacaggatcgtgatggtccggcatggggagtccgagtggaatcagaagaacctattc
tgcggatggttcgatgccaagctatcggagaagggacagcaggaggcctgtgccgctggc
aaagcgctcaaagatgccaaaattgagttcgatgtggcccacacctcggtgctgaccaga
gcccaggatacactcagggccgccctgaagtccagcgagcacaagaagatcccggtgtgc
accacgtggcgcctcaacgagcgccactacggcggactgacgggtctgaataaggccgag
accgccaagaagttcggcgaggagaaggttaagatctggcgccgcagctttgacacccca
ccgccgccaatggagaaggatcacgagtactacgcctgcattgttgaggatccgcgctac
aaggaccaactgaagccggaggagttccccaaatccgagtcactcaagctcaccatcgag
cgcacattgccctattggaacgaggtcatagtgccccagatcaaggacggaatgcgtgtc
ctgatcgccgcccacggcaacagcctgcggggcgtggtcaagcacttggaatgcatctct
gacaaggacataatgagcctcaacctgcccacgggcattcctttcgtctacgaactggac
gagaacctcaagcccttggccacgttgaagttcctcggcgatccggagacggtgaagaag
gcaatggagtcggtggccaaccagtggcaaagccaagtgatccgtgatttccaggtaagt
ccagcagcctccgaagaaggtcagagcaatcagctccttgtaattgtatgccaaacaaaa
gcggcgaatcgaaagtggtgctcactgtggccaggcgaatgtcaagcagcaaataaattt
atttga

DBGET integrated database retrieval system