KEGG   Drosophila simulans: Dsimw501_GD20588Help
Entry
Dsimw501_GD20588  CDS       T01065                                 

Gene name
Dsim_GD20588
Definition
(RefSeq) GD20588 gene product from transcript GD20588-RA
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsimw501_GD20588 (Dsim_GD20588)
   01230 Biosynthesis of amino acids
    Dsimw501_GD20588 (Dsim_GD20588)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD20588 (Dsim_GD20588)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dsimw501_GD20588 (Dsim_GD20588)
Enzymes [BR:dsi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dsimw501_GD20588 (Dsim_GD20588)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dsimw501_GD20588 (Dsim_GD20588)
  Exosomal proteins of melanoma cells
   Dsimw501_GD20588 (Dsim_GD20588)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 292 aa AA seqDB search
MLALARSSWCGQLLCRVANIEARCPFSKSSTGGKQAEKKGKYRIVMVRHGESEWNQKNLF
CGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQDTLRAALKSSEHKKIPVC
TTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRY
KDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECIS
DKDIMSLNLPTGIPFVYELDENLKPLATLKFLGDPETVKKAMESVANQGKAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttggctctggccaggagttcgtggtgtggccaattgctgtgtcgcgtggcgaacatc
gaagcccgctgcccgttctcgaagtcatcaaccggcggaaagcaggccgagaagaagggc
aagtacaggatcgtgatggtccggcatggggagtccgagtggaatcagaagaacctattc
tgcggatggttcgatgccaagctatcggagaagggacagcaggaggcctgtgccgctggc
aaagcgctcaaagatgccaaaattgagttcgatgtggcccacacctcggtgctgaccaga
gcccaggatacactcagggccgccctgaagtccagcgagcacaagaagatcccggtgtgc
accacgtggcgcctcaacgagcgccactacggcggactgacgggtctgaataaggccgag
accgccaagaagttcggcgaggagaaggttaagatctggcgccgcagctttgacacccca
ccgccgccaatggagaaggatcacgagtactacgcctgcattgttgaggatccgcgctac
aaggaccaactgaagccggaggagttccccaaatccgagtcactcaagctcaccatcgag
cgcacattgccctattggaacgaggtcatagtgccccagatcaaggacggaatgcgtgtc
ctgatcgccgcccacggcaacagcctgcggggcgtggtcaagcacttggaatgcatctct
gacaaggacataatgagcctcaacctgcccacgggcattcctttcgtctacgaactggac
gagaacctcaagcccttggccacgttgaagttcctcggcgatccggagacggtgaagaag
gcaatggagtcggtggccaaccagggcaaagccaagtga

DBGET integrated database retrieval system