KEGG   Drosophila simulans: Dsimw501_GD20680Help
Entry
Dsimw501_GD20680  CDS       T01065                                 

Gene name
Dsim_GD20680
Definition
(RefSeq) GD20680 gene product from transcript GD20680-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
dsi00040  Pentose and glucuronate interconversions
dsi00053  Ascorbate and aldarate metabolism
dsi00830  Retinol metabolism
dsi00860  Porphyrin and chlorophyll metabolism
dsi00980  Metabolism of xenobiotics by cytochrome P450
dsi00982  Drug metabolism - cytochrome P450
dsi00983  Drug metabolism - other enzymes
dsi01100  Metabolic pathways
Module
dsi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD20680 (Dsim_GD20680)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD20680 (Dsim_GD20680)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsimw501_GD20680 (Dsim_GD20680)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD20680 (Dsim_GD20680)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD20680 (Dsim_GD20680)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD20680 (Dsim_GD20680)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD20680 (Dsim_GD20680)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsimw501_GD20680 (Dsim_GD20680)
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsimw501_GD20680 (Dsim_GD20680)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 6728564
NCBI-ProteinID: XP_002103905
UniProt: B4QUK1
Position
3R
AA seq 540 aa AA seqDB search
MFPPGRWLLPMFWLISNAICGIRSYRILVIAPFESHSQCMLVTPYIQALKDRGHQLTVIH
AYKHCMHKIEDVTFIRVWYNNNAYADFEESVAIDSVASKWEEISTISKVMVNATLNVLNN
AEVRALMRSGITFDAVVLEAGYSDVLYGMAAHFSAQLIGICTCVADWNINNLVGFSTSTL
TEPIMPFGVKSVKNVWDRIYNWFYTTEEWLLMNLVFLPKQRLIHDHFFGHLEKSFQEIRQ
DFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSDLQVFIDEAEHGVILFSLGL
EQDSKDLPRKTQEILVETFKSVPQRVIWKFDGEPTMSLGSDIYHSKLLPQQAILAHPNVK
LFISHCGMISVIEAAYYAKPVLGLPSFFDQFRNLEIMKEEGAALQLNINSLTVKELKDAV
HSMINEPEYRESALAISQRFRDQPMHPLDTAIYWTEYIIRYKGANHMKVSQSQLKLFDYY
SLDNFIMVVSRLSLVVALVFLALSKSRRWLNHFSTSAKPFLPDDIQHNRKEYLSNFSANI
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctccggggcgatggcttctcccgatgttttggctgatttcgaacgcgatctgt
gggatacgtagttaccgcatcctcgtcatcgccccctttgaatcccactcgcaatgcatg
ctggtgacaccctatatacaggctctgaaagatcggggtcaccagctgacggtgatacat
gcatacaagcactgcatgcacaaaattgaagatgtcaccttcatacgagtatggtataat
aataatgcttatgcagactttgaggaatccgtggcaatcgattcggtggccagtaagtgg
gaagaaattagcactatttcgaaagtcatggttaatgccacactcaacgtactcaataac
gcggaagttcgagcattgatgcgatcgggaatcacatttgatgctgtggtcctggaagct
ggatatagtgacgtgctctatggcatggccgcccatttcagcgcccaactgatcggaatt
tgcacctgcgtggcagattggaatataaataacctggtcggtttttcaacatccactttg
acagagcccataatgccattcggtgtaaagtctgtgaaaaacgtttgggatcgcatctac
aattggttctacacaaccgaagagtggctgctgatgaacttggtatttctaccaaaacag
cgccttatccacgatcacttctttggtcatctggagaagagcttccaggagatccggcaa
gacttcgcattgatgctgcttaatcaacactttagcctgtttcgggccaggcccaatgtg
ccgggaatggttgaagtggctggtctacacattcccaaagaggatccacagctgccgagc
gatctgcaagtgttcattgatgaggcagaacatggagtgatcttgttttctctgggtctg
gaacaggatagtaaagatttgccaaggaaaacgcaggaaattctggtggagactttcaaa
tcggttccacagcgtgtgatttggaagttcgatggtgaacctacgatgagtctgggcagt
gacatttaccactcaaaacttttgccacagcaagcaattttggctcatccaaacgtaaag
ctctttataagccattgcggaatgataagcgttatagaagctgcctactacgcgaagcca
gtattgggccttccatcgttcttcgatcaattcaggaatttggaaatcatgaaggaggag
ggagcagctctgcagttgaacatcaatagcttgacagtaaaggagttgaaggatgcagtg
cacagcatgataaatgagccggaatatcgagagagcgccttggctatttcccaaagattt
agggatcagcccatgcatcccttggatacggccatttattggacggagtacataatacgc
tacaagggggcaaatcacatgaaagtatctcagtcgcagttgaagttgttcgattactat
tccctggacaatttcataatggtcgtatcgcggctatccttggtggtggctttagttttt
ctggccctctcaaaaagcagaagatggctaaatcatttttcgacatctgcaaagccattt
ctacctgatgacattcaacataataggaaggaatatcttagcaatttctctgcgaacatt
taa

DBGET integrated database retrieval system