KEGG   Drosophila simulans: Dsim_GD20686Help
Entry
Dsim_GD20686      CDS       T01065                                 

Definition
GD20686 gene product from transcript GD20686-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsim_GD20686
   00053 Ascorbate and aldarate metabolism
    Dsim_GD20686
   00500 Starch and sucrose metabolism
    Dsim_GD20686
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsim_GD20686
   00860 Porphyrin and chlorophyll metabolism
    Dsim_GD20686
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsim_GD20686
   00982 Drug metabolism - cytochrome P450
    Dsim_GD20686
   00983 Drug metabolism - other enzymes
    Dsim_GD20686
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsim_GD20686
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsim_GD20686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 517 aa AA seqDB search
MRLLPVIAIVFCALSAKPLQTESAKILATLPFPGRSQYIFMESYLKALAAKGHQVTVINA
FKNKETPNMRFIEALKAHDFAEEMMSLLNVPLLWQQLNAIDYILNKFIDTTMEDEGVQKL
VNSGETFDLVLAEMLQMEPLYALAQHFNATLVGFSSFGTDRTIDEAAGNISPISYNPLVT
SPRTDRMTFLERLENHYDVILEDIHRHFVHLPHMRKVFKKYFPNAKKTMEEVMDSFSLIL
LGQHFSLSYPRPYLPNMIEVGGMQISHKPKPLPEDIKQFIEGSPHGVIYFSMGSNVKSKD
LPQETRDTLLKTFAKLKQRVLWKFEDDEMPGKPANVLIKKWYPQPDILAHPNVKLFISHG
GLLSSTESVYFGKPILGLPCFYDQHMNVQRAQRVGFGLGLDLNNLKQEDLEKAIQTLLTD
PSYAKAALAISERYRDQPESAVDRAVWWTEYVIRHNGAPHLRAASRDLNFIQLHSLDTLA
VILAVPLLVTLLILKLSCKLLRGKKQKCPHSDKLKKH
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagattattgcctgtgatcgcgatcgtgttttgcgctttgagcgccaagccgctccaa
acggaaagtgcgaagattttggcaacgctgccgtttccgggtcgatcccagtacatattt
atggagagctacttgaaagccttggcagctaagggtcaccaggtgaccgttatcaatgcc
ttcaagaacaaggagacgccaaacatgcgctttattgaggcactcaaagcgcacgacttt
gctgaagagatgatgagtttgctgaatgtgcctctattgtggcagcagctcaatgccata
gattacatattaaacaaattcatcgatacaacaatggaggacgagggtgtccagaagcta
gttaactcgggagaaactttcgatctggtgctggcggagatgctccaaatggaaccactg
tacgctcttgcccagcatttcaatgccactttagtgggattctccagctttggaaccgat
agaacaattgacgaggcagctggaaatatatcacccatatcatacaacccgctggtgacc
tctcctcgaaccgatcggatgacctttctggagcgcttggaaaaccactacgatgtcatt
ttggaggacattcatcggcacttcgttcacctgccacatatgagaaaggttttcaaaaag
tatttcccgaatgcgaagaaaaccatggaggaagtcatggatagtttttcgttgattctg
ctgggccagcacttttctttgagctatccgcgaccctatttgcccaacatgattgaggtc
ggaggaatgcaaatctcgcacaagccgaaaccactgccagaagacattaaacagtttatt
gagggttcgccacatggtgttatatacttctccatgggctccaatgtgaagagcaaggat
ctgccacaggaaactcgagatacgctgctgaagacctttgccaaattgaagcagcgggtg
ctgtggaaattcgaagatgacgagatgcctggaaagccagctaatgttctgattaagaaa
tggtatccccagccggatattctggcccatccgaatgtgaaattgttcatcagccacggt
ggtctgctgagcagcaccgaaagcgtttacttcggaaaacccatcctgggattgccgtgc
ttctatgatcagcacatgaatgtgcagcgcgcccagcgagtgggctttggcttgggtttg
gatctgaataatctgaagcaggaggatttggaaaaggccatccaaacgctgctcaccgat
ccgagttatgccaaagcagccttggccatttccgagcggtatcgtgatcaaccggaatca
gccgtcgatcgtgctgtctggtggacggagtacgtgatcaggcacaatggtgctccacac
ctgcgagcagcttcccgggatctcaacttcattcaactgcacagcttggacactctcgct
gtgatactggccgtacctctactagtcactctgttaatcctaaagttatcttgtaaatta
ctgagaggcaagaaacagaagtgcccacattctgataagctcaagaaacattag

DBGET integrated database retrieval system