KEGG   Drosophila simulans: Dsim_GD20725Help
Entry
Dsim_GD20725      CDS       T01065                                 

Definition
GD20725 gene product from transcript GD20725-RA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dsim_GD20725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 333 aa AA seqDB search
MSCNYADGLSAYDNKGILGAPESFDSDEDVAEKCQVLADLIKKSGHVVLHTGAGISTSAG
IPDFRGPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVHLMESGYVQYVIS
QNIDGLHLKSGLDRKYISELHGNIYIEQCKKCRRQFVSPTAVETVGQKSLQRACKSSMDS
KGRSCRYGILYDNVLDWEHDLPENDLEMGLMHSTVADLNIALGTTLQIVPSGDLPLKNLK
RGGKFVICNLQPTKHDKKANLIVSSYVDVVLSKVCKLLGVEIPEYSEAADPTKQSKPMEW
TIPTSNVNTFHKQYNKYVKDSKIESKAKKTKYT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaactacgcggatggattgtcagcctacgacaacaagggaatcctgggagca
ccagagagtttcgacagcgatgaggatgtggccgaaaagtgtcaggtactggctgatttg
atcaagaaatccggacacgttgtgctgcacacgggagctggaatcagtacgtccgcaggg
attccggatttccgtggacccaaaggcgtttggaccctggaggagaagggcgagaagccg
gacttcaatgtctccttcgatgaagccagaccaactaaaacccacatggctatcatagcc
ctgattgaaagtggctacgtgcacctgatggaaagtgggtacgtgcagtacgtaatctcc
cagaatattgacggtctccacttgaaatccggactggatcggaagtatatttccgagttg
cacggcaacatttacatcgaacagtgtaagaaatgcagacgacaatttgtgagccctact
gccgtggaaacagtgggtcaaaaatcccttcaacgtgcctgcaagtcttcaatggatagc
aaaggtcgtagctgcagatatggaatcctatacgacaacgttctggactgggagcatgat
cttcccgaaaacgaccttgaaatgggtttgatgcactccaccgtcgctgacctaaatatt
gcgcttggaaccactttacagatcgttcccagcggtgaccttcctttaaagaatctgaaa
cgcggtggaaaatttgtcatttgtaatctgcagccgacaaaacatgacaaaaaggctaac
ttaatcgtatccagctatgtggatgtggttttgtccaaggtgtgtaaactattgggtgtt
gagatacccgaatattcggaggcagccgatcctacaaagcagtccaagccaatggagtgg
accatacccacaagcaatgtaaatacctttcacaaacagtataacaagtatgtaaaagac
tcaaaaattgaatctaaagctaagaaaacgaagtacacgtaa

DBGET integrated database retrieval system