KEGG   Drosophila simulans: Dsimw501_GD20725Help
Entry
Dsimw501_GD20725  CDS       T01065                                 

Gene name
Dsim_GD20725
Definition
(RefSeq) GD20725 gene product from transcript GD20725-RB
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dsimw501_GD20725 (Dsim_GD20725)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     Dsimw501_GD20725 (Dsim_GD20725)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 325 aa AA seqDB search
MSCNYADGLSAYDNKGILGAPESFDSDEDVAEKCQVLADLIKKSGHVVLHTGAGISTSAG
IPDFRGPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHL
KSGLDRKYISELHGNIYIEQCKKCRRQFVSPTAVETVGQKSLQRACKSSMDSKGRSCRYG
ILYDNVLDWEHDLPENDLEMGLMHSTVADLNIALGTTLQIVPSGDLPLKNLKRGGKFVIC
NLQPTKHDKKANLIVSSYVDVVLSKVCKLLGVEIPEYSEAADPTKQSKPMEWTIPTSNVN
TFHKQYNKYVKDSKIESKAKKTKYT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaactacgcggatggattgtcagcctacgacaacaagggaatcctgggagca
ccagagagtttcgacagcgatgaggatgtggccgaaaagtgtcaggtactggctgatttg
atcaagaaatccggacacgttgtgctgcacacgggagctggaatcagtacgtccgcaggg
attccggatttccgtggacccaaaggcgtttggaccctggaggagaagggcgagaagccg
gacttcaatgtctccttcgatgaagccagaccaactaaaacccacatggctatcatagcc
ctgattgaaagtggctacgtgcagtacgtaatctcccagaatattgacggtctccacttg
aaatccggactggatcggaagtatatttccgagttgcacggcaacatttacatcgaacag
tgtaagaaatgcagacgacaatttgtgagccctactgccgtggaaacagtgggtcaaaaa
tcccttcaacgtgcctgcaagtcttcaatggatagcaaaggtcgtagctgcagatatgga
atcctatacgacaacgttctggactgggagcatgatcttcccgaaaacgaccttgaaatg
ggtttgatgcactccaccgtcgctgacctaaatattgcgcttggaaccactttacagatc
gttcccagcggtgaccttcctttaaagaatctgaaacgcggtggaaaatttgtcatttgt
aatctgcagccgacaaaacatgacaaaaaggctaacttaatcgtatccagctatgtggat
gtggttttgtccaaggtgtgtaaactattgggtgttgagatacccgaatattcggaggca
gccgatcctacaaagcagtccaagccaatggagtggaccatacccacaagcaatgtaaat
acctttcacaaacagtataacaagtatgtaaaagactcaaaaattgaatctaaagctaag
aaaacgaagtacacgtaa

DBGET integrated database retrieval system