KEGG   Drosophila simulans: Dsimw501_GD20857Help
Entry
Dsimw501_GD20857  CDS       T01065                                 

Gene name
Dsim_GD20857
Definition
(RefSeq) GD20857 gene product from transcript GD20857-RA
  KO
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dsi  Drosophila simulans
Pathway
MAPK signaling pathway - fly
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsimw501_GD20857 (Dsim_GD20857)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dsimw501_GD20857 (Dsim_GD20857)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dsimw501_GD20857 (Dsim_GD20857)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3R
AA seq 424 aa AA seqDB search
MAERPKNLFATGSSRSRNPPDQLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTR
CFGAQQPQQTPPVASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGAANTHTFTSD
DLEDEGEIGRGAFGAVNKMIFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIY
IVQFYGALFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLK
EELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERA
KGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEF
VDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADILESMEKDGITQFTANQ
QAES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgaccgaaaaatttgtttgcaaccggatccagtcgctcccgcaatcccccg
gatcagctaagcctgaataatcttagcatacgccatccgccctcgtccacgtcgtccact
tcttcgggatccacatcctcgggctcaagttcctcttcacagcataaccatgtgacccgc
tgttttggcgcccagcagccacagcaaaccccgccggtggccagcagtcaagtgccaccg
gtaccggcagcatcgagcagcagcgctgccgatcgtcaccgggagcgaattcgccagcag
gcctgtggcaagctacagtttggtgagggcgctgccaatacacacacatttacttcagac
gatctcgaggatgagggcgaaattggacgcggtgcatttggggcagtcaacaagatgatc
tttaagaaactggacaaggtgatggccgtcaagcgcattcgatccaccgtagacgagaag
gaacagaagcagctgctcatggatctcgaggtggtcatgaagtccaacgagtgcatctac
attgttcagttctatggggcgctgtttaaggagggagactgctggatttgtatggagctg
atggacacctcgttggacaagttttacaagtacatctacgaaaagcagcagcgccacatt
ccagagtccatactggctaagataacagtggccacggtcaatgcgctgaactatttgaag
gaggagctaaagattatccatcgggatgtgaaaccgagcaatattctgttgcaccgtcgc
ggagacataaagctgtgtgattttggtatttcgggtcagctggtcgactctattgccaag
accaaggatgcgggctgcaggccctacatggcgccggagcgcattgatccagagcgtgcc
aagggctacgatgtacgaagcgatgtttggtcattgggcatcactttgatggaggtggcg
actggtaatttcccctatcgtaaatgggactctgttttcgagcagttgtgtcaggttgtg
caaggcgaaccgccgcgacttttgacatcctataacggcatggagttctccaaagagttt
gtggattttgtcaacacttgcctcattaaaaaggagagcgatcggcccaagtatagtcgt
ctgctggagatgcccttcatacgtcgtggtgagacgagccacactgatgttgccgtgtat
gtggccgatatactggagtcgatggagaaagacggcattacgcagtttacggccaaccag
caggcggagagttaa

DBGET integrated database retrieval system