KEGG   Drosophila simulans: Dsim_GD20983Help
Entry
Dsim_GD20983      CDS       T01065                                 

Definition
GD20983 gene product from transcript GD20983-RA
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dsim_GD20983
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsim_GD20983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 364 aa AA seqDB search
MGANVSQLEREIGSDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNAGPSNGNPKATNQGGSTRNGTGTNGANSEPTWVHEIFQGILTSETRCLN
CETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRV
KKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIH
CGSGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQS
RDCA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaatgtgtcgcagctggagcgggagattggctccgatctgttcccgccgaat
gagcactacttcgggctggtgaactttgggaacacctgctacagcaactcggtgctgcag
gccctctacttttgcaagccctttcgcgagaaggtcctcgagtacaaggccaagaacaag
aggcccaaggagacgctgctgtcgtgtctggcggatctgttctacagcattgccacgcag
aagaagaaggtgggctcgattgcgcccaagaagttcatcaccaggctgcggaaggagaag
gaggagttcgataactatatgcagcaggatgcccacgagttcctcaactttctgatcaat
cacatcaatgagatcattctggccgagcggaatgcagggcccagcaatgggaatccaaag
gccaccaatcagggcggaagcacaaggaacggaacgggaaccaatggggccaactcggag
cccacctgggtgcacgagatctttcagggcatactcacgtcggagaccaggtgcctcaac
tgcgagacggtgagcagcaaggacgagaatttcttcgacctccaggtggacgtggaccag
aacacctcgataacgcactgcctgcggtgcttcagcaacacggagaccctgtgttcggac
aacaagttcaagtgcgacaattgctgcagttatcaggaggcgcagaagaggatgcgtgtg
aagaagttgcccatgatcctggccctgcatctcaagcgcttcaagtacatggagcagttt
aataggcacatcaaggtatcgcatcgcgttgtgtttccactggaactgaggctcttcaac
acctccgatgatgcagtgaatcccgatcgtctctacgatctgaccgctgtggttatccac
tgcggttccggaccaaatcgtggccattatatatccattgtgaagagtcacggactgtgg
ctactattcgacgatgatatggtggacaaaatcgaggcttccaccatcgaggacttctac
ggtctgacctcggacatacacaagtcctcggagacgggctacatactgttctatcagtcg
cgggactgcgcctaa

DBGET integrated database retrieval system