KEGG   Drosophila simulans: Dsimw501_GD21030Help
Entry
Dsimw501_GD21030  CDS       T01065                                 

Gene name
Dsim_GD21030
Definition
(RefSeq) GD21030 gene product from transcript GD21030-RA (EC:3.2.1.45)
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dsimw501_GD21030 (Dsim_GD21030)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsimw501_GD21030 (Dsim_GD21030)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsimw501_GD21030 (Dsim_GD21030)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dsimw501_GD21030 (Dsim_GD21030)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 599 aa AA seqDB search
KFGGLIIRKQAGLSFLSSVVDGPSSGPHCFGPRGADMKTPLLGFLSAVIAISAGAPDWQL
PCDLRETSHGSVCVCNSTYCDYLEPPQLTDISQIVVISSSKDGLRFKKTTGDLSEKKPIT
IDDKQFTDENFKADAIVVDQERAWLQLANIPQSLFINASIKTYRISVKREQSFQNVSIFG
GAFTGTVSYLLKELPEELQDHVYRSYFHPVGIAYNTIRMSIGGSDFDMEPWAYNELPLHD
PKLSNFTELDPRDLQKVEQLKRLKTIAKVDTLKIIGAAWSAPTWMKSNNRWTGFGQLKSE
YYQTWALYHLKFLELMRAKNMPIWAISTGNEPLNGVIGFFFVHFMSMGWTPWQQAIWLND
NLGPTIRNSAESKVLIFGNDDQRYTYPTWFRRMRSSRNNSLNYLDGLAVHWYWDELIAPQ
LIDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRAYTQDLTHNFNGWLDW
NLVLDEQGGPNYIKNFVDAPIIVNATSRAEIYKQPIFYAIGHFSKFLPPESVRIETRIEN
QGNPFTQLSVVGFQRPDGSVALIIYNGQNLPVDVALDDSQRGAIQLRLPPRSWHTVLYK
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
aaattcggtggcttgattattcgaaagcaggccggactctcgtttctgagctcagttgtg
gacgggccttcgagcgggccgcattgttttggtcccaggggtgcagacatgaagacacca
ttgcttggctttctttctgcagtgatcgcaatctctgcaggtgctcccgactggcagttg
ccctgcgatttgcgcgaaacgagccatggaagcgtgtgtgtctgcaacagcacctactgc
gactatctggaaccgccgcagctcactgatatctcgcagattgtggtgattagctccagc
aaggatggcttgcgcttcaagaagacaacaggggatctctcggaaaagaaacccataaca
atagatgacaaacagttcaccgatgagaacttcaaggcagatgcgattgtggtggatcag
gagagagcctggctgcagttggccaacattccccaaagcctttttattaatgccagcatt
aagacatatcgcatatcggtgaaacgagagcagagttttcaaaatgtctccatttttggc
ggggcctttacaggtacagtctcgtacttactcaaagaactaccggaggagctacaggat
catgtctacagatcctatttccatccggttggaattgcctacaacactatacgaatgtcc
attgggggctccgactttgatatggaaccctgggcatacaatgaattgcctcttcatgat
ccgaaattgagcaacttcaccgagcttgatccgcgggatctgcagaaagtggaacagctg
aaacgccttaagaccatcgctaaagtagatactctgaaaatcataggcgccgcctggagt
gctccaacctggatgaagagcaataaccgctggacaggattcgggcagctgaaatcggaa
tactaccaaacgtgggccctctatcacctcaaatttctcgaacttatgcgggctaaaaat
atgccgatttgggccatatccactggcaatgagccgttaaacggcgtcattggcttcttt
tttgtacacttcatgagcatgggctggacgccctggcagcaggctatctggctgaacgac
aatctgggcccgaccatcaggaactcggcggagagcaaggtgctcatctttggcaacgac
gatcagcggtacacctacccaacgtggttccggaggatgcgctcctcacgcaacaattcg
ctgaactacttggatggcctagctgttcactggtactgggatgaactgatagctccacaa
ctcatcgaccaggcacacacggatatgcccaataagctgctattgaacacggagtcctgc
atcggtgataagccatggcagacccatggtcccgagctgggcagctggcagcgtggtgag
agctacatgagggcctacacccaggatctgacgcacaacttcaacggctggctggattgg
aatctcgtgctggacgaacagggcggtccgaactacattaagaacttcgtggacgctccg
atcattgtgaatgccacgagccgggctgagatatacaagcagccgatcttctatgccata
ggccacttctccaagttcctgccgccggaatccgtgcgcatcgagacgcgtatcgagaac
cagggcaatcccttcacccagctaagtgttgtgggcttccagcgaccagacggtagcgtg
gcgttgatcatctacaatggccagaacctgccggtggacgtggccctcgatgatagccag
cgtggggcgatccagctccgcctgccgccgcgctcctggcacacggtgctctacaaatga

DBGET integrated database retrieval system