KEGG   Drosophila simulans: Dsim_GD21030Help
Entry
Dsim_GD21030      CDS       T01065                                 

Definition
GD21030 gene product from transcript GD21030-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dsim_GD21030
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsim_GD21030
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsim_GD21030
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dsim_GD21030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 880 aa AA seqDB search
MKRIAGAPDWQLPCDLRETSHGSVCVCNSTYCDYLEPPQLTDISQIVVISSSKDGLRFKK
TTGDLSEKKPITIDDKQFTDENFKADAIVVDQERAWLQLANIPQSLFINASIKTYRISVK
REQSFQNVSIFGGAFTGTVSYLLKELPEELQDHVYRSYFHPVGIAYNTIRMSIGGSDFDM
EPWAYNELPLHDPKLSNFTELDPRDLQKVEQLKRLKTIAKVDTLKIIGAAWSAPTWMKSN
NRWTGFGQLKSEYYQTWALYHLKFLELMRAKNMPIWAISTGNEPLNGVIGFFFVHFMSMG
WTPWQQAIWLNDNLGPTIRNSAESKVLIFGNDDQRYTYPTWFRRMRSSRNNSLNYLDGLA
VHWYWDELIAPQLIDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRAYTQ
DLTHNFNGWLDWNLVLDEQGGPNYIKNFVDAPIIVNATSRAEIYKQPIFYAIGHFSKFLP
PESVRIETRIENQGNPFTQLSVVGFQRPDGSVALIIYNGQNLPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEQ
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcaggtgctcccgactggcagttgccctgcgatttgcgcgaaacgagc
catggaagcgtgtgtgtctgcaacagcacctactgcgactatctggaaccgccgcagctc
actgatatctcgcagattgtggtgattagctccagcaaggatggcttgcgcttcaagaag
acaacaggggatctctcggaaaagaaacccataacaatagatgacaaacagttcaccgat
gagaacttcaaggcagatgcgattgtggtggatcaggagagagcctggctgcagttggcc
aacattccccaaagcctttttattaatgccagcattaagacatatcgcatatcggtgaaa
cgagagcagagttttcaaaatgtctccatttttggcggggcctttacaggtacagtctcg
tacttactcaaagaactaccggaggagctacaggatcatgtctacagatcctatttccat
ccggttggaattgcctacaacactatacgaatgtccattgggggctccgactttgatatg
gaaccctgggcatacaatgaattgcctcttcatgatccgaaattgagcaacttcaccgag
cttgatccgcgggatctgcagaaagtggaacagctgaaacgccttaagaccatcgctaaa
gtagatactctgaaaatcataggcgccgcctggagtgctccaacctggatgaagagcaat
aaccgctggacaggattcgggcagctgaaatcggaatactaccaaacgtgggccctctat
cacctcaaatttctcgaacttatgcgggctaaaaatatgccgatttgggccatatccact
ggcaatgagccgttaaacggcgtcattggcttcttttttgtacacttcatgagcatgggc
tggacgccctggcagcaggctatctggctgaacgacaatctgggcccgaccatcaggaac
tcggcggagagcaaggtgctcatctttggcaacgacgatcagcggtacacctacccaacg
tggttccggaggatgcgctcctcacgcaacaattcgctgaactacttggatggcctagct
gttcactggtactgggatgaactgatagctccacaactcatcgaccaggcacacacggat
atgcccaataagctgctattgaacacggagtcctgcatcggtgataagccatggcagacc
catggtcccgagctgggcagctggcagcgtggtgagagctacatgagggcctacacccag
gatctgacgcacaacttcaacggctggctggattggaatctcgtgctggacgaacagggc
ggtccgaactacattaagaacttcgtggacgctccgatcattgtgaatgccacgagccgg
gctgagatatacaagcagccgatcttctatgccataggccacttctccaagttcctgccg
ccggaatccgtgcgcatcgagacgcgtatcgagaaccagggcaatcccttcacccagcta
agtgttgtgggcttccagcgaccagacggtagcgtggcgttgatcatctacaatggccag
aacctgccgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncatgagcaa
tga

DBGET integrated database retrieval system