KEGG   Drosophila simulans: Dsim_GD21106Help
Entry
Dsim_GD21106      CDS       T01065                                 

Definition
GD21106 gene product from transcript GD21106-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dsi  Drosophila simulans
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dsim_GD21106
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dsim_GD21106
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dsim_GD21106
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dsim_GD21106
Spliceosome [BR:dsi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dsim_GD21106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 327 aa AA seqDB search
MSDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAKVVGKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
RFVYPNFGSSGRPLTPPRGANNKNKKK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcatgaacatcgacagtatcatctcgcgcctgctggaggtgcgcggcgca
cgaccgggaaaaaatgtgcagctatcagagagcgagatccgcagcctgtgcctcaagtcc
cgcgagatattcctgtcgcagcccatactcctggagctggaggcaccgctgaagatctgc
ggcgacatacacggacaatactatgacctcttgcgcctgttcgaatacggcggctttccg
cccgagtccaactacctgttcctgggcgactacgtcgatcgtggcaagcagtccctggag
acgatatgcctgctgctggcctacaagatcaagtacgcggagaacttcttcttgctgcgc
ggcaaccatgagtgcgccagcatcaaccgcatctacgggttctatgacgaatgcaaacgt
cgctacaccatcaagctgtggaaaactttcacggactgcttcaactgcctgccggtggcc
gccatcgtggatgagaagatcttctgttgccacggcggcctgagtccagatctgtcgtcc
atggagcagatacggcgcatcatgcgtcccacagacgtgcccgatcagggactgctgtgc
gatctgctgtggtcggatccggataaggataccatgggctggggcgagaatgatcgcggc
gtgagcttcacatttggagcaaaggttgtgggtaaatttttacagaagcacgaatttgac
ctgatctgtcgggctcatcaggtggtggaggacggttatgagttctttgccaaacgtcag
ctagtgacgctcttctcggcgcccaactactgcggggagttcgacaacgcgggtgccatg
atgtccgtggacgacacattgatgtgctccttccagatattgaaacccgccgacaagcga
cgatttgtatatcccaactttggcagctcaggacgtcctttgacaccgccacgcggagcc
aacaataaaaacaagaaaaaataa

DBGET integrated database retrieval system