KEGG   Drosophila simulans: Dsim_GD21392Help
Entry
Dsim_GD21392      CDS       T01065                                 

Definition
GD21392 gene product from transcript GD21392-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dsim_GD21392
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dsim_GD21392
Spliceosome [BR:dsi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dsim_GD21392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1125 aa AA seqDB search
MSNELSELIALGCPDLAAQKPQGGSTQVELILNTERRLSIKQMTATDLATLRATAAAEAE
ARSRAQAEAEARAIAQEQLRQAREAESKARARAALEVQAQLQRVMESEKRRQQEEEERRS
RQQAEEEQEDDEDEDEEEELTKGSLPTNSGPRERIASLPSNIDDAMEMHLLSVSQPKASS
KDDSPPKKSTSHIADSIELLRMQRAARDARSHNRSRERSISPDRNRERSAAPDRLQSSAS
MSSLDSASASASRQPSKAGSRRGSTTSATGVEPPLMAAPPQPTKFPLTKTVSAPNMDRRR
SSLTSLFPGPSPLVAPEPSLHTNPDPRVQEQIEEDRRRRRMDDGYREIPSGKMVHRTKTP
PPVGTNLGVSLKRVTAPSGSITIKPKESPMLGVVLRRVEKKTVPQKSILDDDKPLYHFSI
VRSDHKEHVPAQKPKPKPAPPAAKPSPGGILTGPQVIRNAPKQPVPAKPQRPMPGVPITI
TKIEGDKIIIIKKIIVPKNSKIPEQYLQVGRRRVGDRLVVSVVRLVFGVSLLLCFVRNLF
YRIYLDAASPSLRTKEESQPAMQKPTPPPASGQQFFQVVSPQFASVLSSSIPESKCAVRS
PISSPLAIRKSRPPLLPASPKSTPPLPRKHHPLAYNAATGTISSASGAALPSRLMTTIAS
SPASSISLSSCSSPSSSPPPPVPCRAPKNPSRPVAAPAAPPPSTSNEISLDKLLQQQQEL
EEKSAAATNSAKMDANFYDAEIEMMNKYLKSLPDYSELDRKLHQEFQECEDLYDKIKRQQ
QPLAKSNSQQSVTKAVGPGVPAISSGLSKSSSINFAQNPSSRAAAPRLAYPSIFSQAAGE
PKLQRSISSSNMPISAPTLMRPLPTKNGLQSGSNLSLNKQLMNEFWSENLTSSQKRQTPK
RTFWNYEKICGAQLGDAGQPFKVDAKTAKKLAIFDPTVAEAAQKELQRPQQSQVPQSQPH
RLQKNASLSHLDLKVRQAVTKDDLYKLICNEQSPLAGSNFVSRVPVKQQFPAQQQQVLPK
SMSMTHVPGGGQPMGAPLLRTSSRTHIPCYMKNLPSLSRSTSNSAILMTQPRKEPPPKEP
LKAPAPLPAIAAAAPTVGKPSGVLKSSSSSSVLPLTALCRCLLSP
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaacttagcgaactgatcgcccttggctgtccagacctcgcggcacaaaag
ccgcagggcggtagcacccaggtggagttgatcctcaacactgagcgccgcctgagcata
aagcagatgacggccacggatttggccactctaagggcaacagcagccgcggaagcggag
gccagatctcgagcgcaagcggaggcggaagctcgagcaattgcccaggaacagttgcgc
caggcccgcgaggccgagtccaaggccagagcacgtgctgccctcgaggtgcaggcccag
ctgcagcgggtgatggagagcgagaaacgcaggcaacaggaagaggaggaaaggcgcagc
aggcaacaagcagaggaggagcaggaggatgatgaagacgaggatgaggaagaggaactg
accaagggttcccttccaaccaattcaggtccaagagaacgcattgcttcgcttcccagc
aacatagatgatgccatggagatgcaccttcttagcgtttcgcagccgaaggcctcttcc
aaagatgactcaccgcctaagaagagtacctctcacatagcggactcgattgagctgctg
agaatgcagcgagctgctcgggatgcccgttcccacaatcgcagtcgagagcggtccatt
tcccctgatcgtaatcgcgaaaggagcgctgctccagatcgcctccagagttctgctagc
atgagcagtttggactcggccagtgcatcggcatccagacaacccagcaaggccggtagt
cgacgtggtagcactacgagtgccactggtgtggagccaccacttatggcagcacctcca
cagcctaccaaatttccactcactaagacggtgtcagcgcccaacatggaccgccggcgg
agcagtctgacatcgctcttccctgggccatcgccattggtggcacccgaaccatctctg
cacaccaatcccgatccaagggttcaagaacaaattgaagaggatcgtcgtcgccggcga
atggacgatggttaccgtgagatacccagcggaaaaatggtgcatcgaacgaagacaccg
ccaccagtgggcactaaccttggagtaagcctcaagcgggtgacagcgcccagtggatcg
ataaccatcaagcccaaggagtcgcccatgctgggagtcgtactgcgtagagtggagaag
aaaactgtaccgcagaagagcattctggacgacgataaaccactgtaccacttctccatt
gtgcgcagcgaccacaaggaacacgtgcctgctcagaaaccaaaacccaagcctgctcct
ccagctgctaaaccaagtcccggtggcatcctcactggaccccaagtaattcgaaacgct
cccaagcaacctgtgcccgcaaagccacagcgtcctatgcccggcgttcccatcactatt
accaagatcgagggcgacaagattatcatcatcaagaagatcattgtgcctaagaacagt
aagataccggagcagtatctgcaggttggtcgtcgtcgtgttggtgatcgccttgtggtg
tctgtagttcgtctggtgtttggtgtctccctccttttgtgttttgttcgaaatctgttt
tatagaatttacctcgatgccgcatcgccaagcctaagaacaaaagaggaatcccagcca
gctatgcagaaacctacgccgccgccggccagtggccagcagttctttcaggtggtctcc
ccgcagttcgcctctgtgctatcatccagcatcccggagagcaagtgtgcggtgcgttct
ccgatatcctccccactagcaatccggaagagtcgtccacctctgctgccggcgagtcca
aagtccactcctccactaccgaggaaacatcaccctctggcttacaacgcggcaacggga
acaatcagcagtgcctctggagcagcgttgccttcccggttaatgaccaccattgcctcc
agcccggcttctagtatatcgctgtcctcctgtagttcaccttcatcatctccaccaccg
ccagtaccatgtcgagctcctaagaatcccagtagacctgttgctgcgcctgctgcccca
cctccatccacctcgaacgaaatcagtttggacaagttgctgcaacagcagcaggagcta
gaggagaaatccgcggcagccacaaacagcgcaaaaatggatgcaaacttctacgatgcc
gagattgagatgatgaacaagtatcttaagagcctgcctgactacagcgaactggacagg
aagctgcaccaggagttccaggagtgcgaggatctctatgacaagatcaagcgtcagcag
cagccgctggccaagtccaattcgcagcaatcggtcacgaaggcagtaggaccaggagtg
cctgcgatctcctccggcttatccaagtcttcttcaattaacttcgcccagaatcccagc
agtcgtgcagctgctccgcgtttggcctatccctcgatattttcccaggctgcaggcgaa
cccaagctgcagcgcagcatttcaagttctaatatgccaataagtgcacctactctaatg
cgtccgctgcccaccaaaaatggcctgcaaagtggctccaatctgtcccttaacaaacag
ttgatgaacgaattctggagcgagaatctcaccagttctcaaaagcggcaaacgcctaag
cgaaccttttggaactacgagaagatctgcggtgcccagttgggcgatgcaggacaacct
tttaaggtggatgcaaagactgctaagaaattggctatatttgatcccacagttgcggag
gccgctcagaaggagctgcagcgacctcagcagtcacaggtgcctcaaagtcagccccac
agactgcagaagaatgcctctttgtcgcacctggatctcaaggtgcgtcaggcggtgacc
aaggacgatctctataagctgatctgcaacgagcaatcgccgttggcaggatcgaatttt
gtgagtagagtcccggtgaagcagcaatttccagcacagcagcaacaggtgcttccaaag
agcatgtccatgacgcatgtgccgggtggtggtcaacccatgggagctccattgctgcga
acttctagtcgcactcatataccctgctacatgaagaatctaccctctttgagcaggagc
acatcaaactctgcaatactcatgacccaaccgcgaaaggaacctccaccaaaggaacct
ctgaaagctccagcaccacttcctgccatagctgctgctgcaccgactgtgggcaaacct
agtggcgtcctaaagagttccagcagttcctctgtattgcccctcaccgcgttgtgccgc
tgccttctttcgccctag

DBGET integrated database retrieval system