KEGG   Drosophila simulans: Dsim_GD21429Help
Entry
Dsim_GD21429      CDS       T01065                                 

Definition
GD21429 gene product from transcript GD21429-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dsim_GD21429
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsim_GD21429
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsim_GD21429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1079 aa AA seqDB search
MLLHQYMHEYDVNERKEEPASLPPTQNDTTDTEINSQLLQDQRNQEQDNSQPPQENPNNQ
QEKDTLHVSVLYPLVVSAQLADSQPILTANSPKLSPVKKRQRRVYVADTSRCYSLRSRQE
PATKDPLEGDLKQPDVAPPPPPLQAPSPTPTESTEYTPSELFKPEFWNRIEEAQEAKPVG
KKRRTAGGLKRTRGNKLLRELEIQSPETAAAIAAAQAELNAAGKSGAAGARSSRKRTNTM
SLYDRRFQTTTEERRVANGYGGNAARSVTGSSSNEIESQETQSHQYYGPNGGSSAAGAGA
GLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHSLHHLIQDLNVVQQTIVR
QQTARSASLGRNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSV
TEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRE
TNQSLIKAIGECPEVIANGYIANPDEVETGEGQDRTDSTASQNLNAGNGSLATSQTTTTK
TSFFSRKSKRKDEVKSSKSTRVQSPLKESSPTAGGITGAGTAHATANSLFYLNTVDLSGA
SSTSGSASTSASGVVATSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFF
SSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCITKE
YFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTFTLPCFC
ATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNS
QTMASQAVPSNENAAPNNGSSSVASTPVIAAASALASSGNILMKKMKFGRSKASSSGDMS
KNVKQVNGITSKNITNGIGKLSISTTCQGVNCCAMRLCCSQQTSSSNSASCSDFSEESLQ
NGSNSNLSFGGSGSTYPTGYGSTGRGGVRANYAHGGPDPIWYMCDDDKIKAMTQREFEEL
LSPTRKITITPYLLFYARFDLQPQKATPPKPGSSSTPPPPSSAQSSWSNENVPSGSHKI
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgttgctccaccaatatatgcacgaatatgacgtaaatgagcgcaaagaggaaccagcc
agtcttccacccacacaaaacgacaccactgacactgaaatcaacagccagctactacag
gatcagcgaaatcaggaacaggataacagccagccgcctcaggaaaatccaaataatcag
caggagaaggacacattgcatgtttccgtgctttatcctctggtagtctccgcgcagctg
gcagacagtcaaccgattctgactgcgaactcgccgaagctatctccagttaaaaagcgt
cagcggcgcgtttatgttgcggacacctcgcgctgttacagtctacgttcccggcaagag
cccgcgaccaaggacccactcgaaggcgacctaaagcagcccgacgtcgctccaccacct
ccgcctcttcaggcgccatcgcccacgcccacagagtccacagaatacacaccttcagaa
ctatttaaaccggagttctggaaccgcattgaggaggcccaagaagcaaagcccgttggg
aagaagcgccgaaccgctggaggactcaaaagaacgcggggcaacaagcttctgagagag
cttgagatccaatcgccggaaacggcggccgctattgcggcagcacaggctgaacttaac
gccgccggaaagtcgggagcagcaggagcgcggtccagccgcaagaggaccaacacgatg
tctctatacgatcggcgattccagaccaccaccgaggagcgccgcgtggctaacggatac
ggaggcaatgctgcgcgatcggtcactggctcctcgtcaaacgagatcgagtcccaggag
acgcagagccatcagtattatggtcccaacggcggcagcagtgccgcaggagcaggcgca
ggcttgaacggaagcgcggcggccctgaaccatgccccttccatgggcacactgtgcaac
attggcaacagttgctacttgaattcggtggtttacaccctgcgctttgccccgcacttt
ttgcacagcctacaccacctgatacaggacttgaatgttgtgcagcagacgatagtccgc
caacaaacggccaggtccgcgtccctcggcaggaatgtgagtgccgctcagttggagcac
gcccgcagctggagcagcaaggatctggccaccagtacggatcagtacagcggtcagaac
ggcggagttaatagcggaaacggtggcagcggttcgagcaagtcgactcatcagtcggta
accgaaaaactccacgaactgtataacaacctgcacggcaacgagatggcagactccacg
gagccctaccacgcggacacgctgctgcacgccatccaggacgtaaacgccacctttgaa
ggcaaccagcagcaggacgcacacgaattcctaatgtgcgtgcttaattgcataagggaa
acgaatcagtctttgatcaaggccattggcgagtgtcctgaggtcatcgcaaatgggtac
atagccaacccggatgaggtcgaaaccggagagggccaggatcgcactgattcgactgcg
tcgcagaacctgaacgctggcaatggatcgctggcaactagtcaaacaaccacgaccaaa
acgtcgttcttctctcgcaaatcaaaaagaaaagacgaggtcaagtcatccaagtcgacg
cgcgttcagtcgccactcaaggagagtagtcccacggcgggcgggataaccggtgctggc
acagcccatgccaccgccaacagcctgttctacctgaacacagttgatctcagcggcgcc
agcagcaccagcggaagtgccagtacgagtgccagtggcgtggttgcaacaagtgcagct
ttgcccactccaccacaggctacaaaatactccagtgacgacgagatgaattccgccacc
gtgctgaaggacaaaatgcggctggaggagcgaatacgggaactcaacctgaacttcttc
agctcggacttcgaaggcattgtggtgctgaccaccaagtgcctcagttgcgagacgatc
acgcggcaaaagcagggcatgcttgatatttctgtgccggtgccgatctcggggtacgac
aatgccgatctccaagacaaaccgagcacctatatacagaattcctgcattacgaaagag
tatttccgcggggagaataagtatagttgcaaccagtgcaccggctacaccgaagccatc
cgctccatctcgtacgaggtgctgccgcggttactggtcattcagctgaatcgattctct
ggcggcatggagaaggtgagtacgtacgtgccgaccaccttcactctgccctgtttctgt
gccacctgctgtgagctgggcgagggcaacaagctgcacgtttacaagctgtacagcgtg
atcacgcatgtgggagccaccctgacggtgggccactacatcgcctatacgtgcttcttg
gatctcgccagtgactatgtcaactgccctaaggatcgcaggaatacgatgacgaactcg
caaacgatggcttcgcaagcagtgccctccaatgagaatgctgcgccaaacaatggtagc
agctccgtggccagcactccagtcattgcagcagcttcggctttggcctcctcgggcaac
attttgatgaagaagatgaagttcggtcgcagcaaggcctccagcagcggtgatatgagc
aagaacgttaagcaggttaatgggataaccagcaagaacatcaccaatggaattggcaag
ctgagcataagcaccacctgccagggagtcaactgctgtgccatgagactgtgttgtagc
cagcagacgagcagcagcaactcggccagttgcagcgatttcagcgaggagtccctacaa
aatggaagcaacagcaatctcagcttcggaggatcgggcagcacctatcccacgggctac
ggaagcacgggtcgcggtggtgtcagagccaactacgcccacggaggtcctgatcccatt
tggtatatgtgcgacgacgacaagatcaaggccatgacccaaagggagttcgaggagctg
ctttcgcccacgcggaagatcacaataacgccctatttgctcttttacgcgcgattcgat
ctgcagccgcaaaaggcgacgccgccgaagcctggatcatcctcaacgcctccgccaccg
tcgtcggcacagagttcgtggtcgaatgaaaacgttcccagcggctcgcacaaaatttga

DBGET integrated database retrieval system