KEGG   Drosophila simulans: Dsimw501_GD21429Help
Entry
Dsimw501_GD21429  CDS       T01065                                 

Gene name
Dsim_GD21429
Definition
(RefSeq) GD21429 gene product from transcript GD21429-RC (EC:3.4.19.12)
  KO
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dsimw501_GD21429 (Dsim_GD21429)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsimw501_GD21429 (Dsim_GD21429)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsimw501_GD21429 (Dsim_GD21429)
Ubiquitin system [BR:dsi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dsimw501_GD21429 (Dsim_GD21429)
DNA repair and recombination proteins [BR:dsi03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     Dsimw501_GD21429 (Dsim_GD21429)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 1073 aa AA seqDB search
MHEYDVNERKEEPASLPPTQNDTTDTEINSQLLQDQRNQEQDNSQPPQENPNNQQEKDTL
HVSVLYPLVVSAQLADSQPILTANSPKLSPVKKRQRRVYVADTSRCYSLRSRQEPATKDP
LEGDLKQPDVAPPPPPLQAPSPTPTESTEYTPSELFKPEFWNRIEEAQEAKPVGKKRRTA
GGLKRTRGNKLLRELEIQSPETAAAIAAAQAELNAAGKSGAAGARSSRKRTNTMSLYDRR
FQTTTEERRVANGYGGNAARSVTGSSSNEIESQETQSHQYYGPNGGSSAAGAGAGLNGSA
AALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHSLHHLIQDLNVVQQTIVRQQTARS
ASLGRNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVTEKLHE
LYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRETNQSLI
KAIGECPEVIANGYIANPDEVETGEGQDRTDSTASQNLNAGNGSLATSQTTTTKTSFFSR
KSKRKDEVKSSKSTRVQSPLKESSPTAGGITGAGTAHATANSLFYLNTVDLSGASSTSGS
ASTSASGVVATSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFSSDFEG
IVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCITKEYFRGEN
KYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTFTLPCFCATCCEL
GEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNSQTMASQ
AVPSNENAAPNNGSSSVASTPVIAAASALASSGNILMKKMKFGRSKASSSGDMSKNVKQV
NGITSKNITNGIGKLSISTTCQGVNCCAMRLCCSQQTSSSNSASCSDFSEESLQNGSNSN
LSFGGSGSTYPTGYGSTGRGGVRANYAHGGPDPIWYMCDDDKIKAMTQREFEELLSPTRK
ITITPYLLFYARFDLQPQKATPPKPGSSSTPPPPSSAQSSWSNENVPSGSHKI
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacgtaaatgagcgcaaagaggaaccagccagtcttccacccacacaa
aacgacaccactgacactgaaatcaacagccagctactacaggatcagcgaaatcaggaa
caggataacagccagccgcctcaggaaaatccaaataatcagcaggagaaggacacattg
catgtttccgtgctttatcctctggtagtctccgcgcagctggcagacagtcaaccgatt
ctgactgcgaactcgccgaagctatctccagttaaaaagcgtcagcggcgcgtttatgtt
gcggacacctcgcgctgttacagtctacgttcccggcaagagcccgcgaccaaggaccca
ctcgaaggcgacctaaagcagcccgacgtcgctccaccacctccgcctcttcaggcgcca
tcgcccacgcccacagagtccacagaatacacaccttcagaactatttaaaccggagttc
tggaaccgcattgaggaggcccaagaagcaaagcccgttgggaagaagcgccgaaccgct
ggaggactcaaaagaacgcggggcaacaagcttctgagagagcttgagatccaatcgccg
gaaacggcggccgctattgcggcagcacaggctgaacttaacgccgccggaaagtcggga
gcagcaggagcgcggtccagccgcaagaggaccaacacgatgtctctatacgatcggcga
ttccagaccaccaccgaggagcgccgcgtggctaacggatacggaggcaatgctgcgcga
tcggtcactggctcctcgtcaaacgagatcgagtcccaggagacgcagagccatcagtat
tatggtcccaacggcggcagcagtgccgcaggagcaggcgcaggcttgaacggaagcgcg
gcggccctgaaccatgccccttccatgggcacactgtgcaacattggcaacagttgctac
ttgaattcggtggtttacaccctgcgctttgccccgcactttttgcacagcctacaccac
ctgatacaggacttgaatgttgtgcagcagacgatagtccgccaacaaacggccaggtcc
gcgtccctcggcaggaatgtgagtgccgctcagttggagcacgcccgcagctggagcagc
aaggatctggccaccagtacggatcagtacagcggtcagaacggcggagttaatagcgga
aacggtggcagcggttcgagcaagtcgactcatcagtcggtaaccgaaaaactccacgaa
ctgtataacaacctgcacggcaacgagatggcagactccacggagccctaccacgcggac
acgctgctgcacgccatccaggacgtaaacgccacctttgaaggcaaccagcagcaggac
gcacacgaattcctaatgtgcgtgcttaattgcataagggaaacgaatcagtctttgatc
aaggccattggcgagtgtcctgaggtcatcgcaaatgggtacatagccaacccggatgag
gtcgaaaccggagagggccaggatcgcactgattcgactgcgtcgcagaacctgaacgct
ggcaatggatcgctggcaactagtcaaacaaccacgaccaaaacgtcgttcttctctcgc
aaatcaaaaagaaaagacgaggtcaagtcatccaagtcgacgcgcgttcagtcgccactc
aaggagagtagtcccacggcgggcgggataaccggtgctggcacagcccatgccaccgcc
aacagcctgttctacctgaacacagttgatctcagcggcgccagcagcaccagcggaagt
gccagtacgagtgccagtggcgtggttgcaacaagtgcagctttgcccactccaccacag
gctacaaaatactccagtgacgacgagatgaattccgccaccgtgctgaaggacaaaatg
cggctggaggagcgaatacgggaactcaacctgaacttcttcagctcggacttcgaaggc
attgtggtgctgaccaccaagtgcctcagttgcgagacgatcacgcggcaaaagcagggc
atgcttgatatttctgtgccggtgccgatctcggggtacgacaatgccgatctccaagac
aaaccgagcacctatatacagaattcctgcattacgaaagagtatttccgcggggagaat
aagtatagttgcaaccagtgcaccggctacaccgaagccatccgctccatctcgtacgag
gtgctgccgcggttactggtcattcagctgaatcgattctctggcggcatggagaaggtg
agtacgtacgtgccgaccaccttcactctgccctgtttctgtgccacctgctgtgagctg
ggcgagggcaacaagctgcacgtttacaagctgtacagcgtgatcacgcatgtgggagcc
accctgacggtgggccactacatcgcctatacgtgcttcttggatctcgccagtgactat
gtcaactgccctaaggatcgcaggaatacgatgacgaactcgcaaacgatggcttcgcaa
gcagtgccctccaatgagaatgctgcgccaaacaatggtagcagctccgtggccagcact
ccagtcattgcagcagcttcggctttggcctcctcgggcaacattttgatgaagaagatg
aagttcggtcgcagcaaggcctccagcagcggtgatatgagcaagaacgttaagcaggtt
aatgggataaccagcaagaacatcaccaatggaattggcaagctgagcataagcaccacc
tgccagggagtcaactgctgtgccatgagactgtgttgtagccagcagacgagcagcagc
aactcggccagttgcagcgatttcagcgaggagtccctacaaaatggaagcaacagcaat
ctcagcttcggaggatcgggcagcacctatcccacgggctacggaagcacgggtcgcggt
ggtgtcagagccaactacgcccacggaggtcctgatcccatttggtatatgtgcgacgac
gacaagatcaaggccatgacccaaagggagttcgaggagctgctttcgcccacgcggaag
atcacaataacgccctatttgctcttttacgcgcgattcgatctgcagccgcaaaaggcg
acgccgccgaagcctggatcatcctcaacgcctccgccaccgtcgtcggcacagagttcg
tggtcgaatgaaaacgttcccagcggctcgcacaaaatttga

DBGET integrated database retrieval system