KEGG   Drosophila simulans: Dsimw501_GD21468Help
Entry
Dsimw501_GD21468  CDS       T01065                                 

Gene name
Dsim_GD21468
Definition
(RefSeq) GD21468 gene product from transcript GD21468-RA
  KO
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dsi  Drosophila simulans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dsimw501_GD21468 (Dsim_GD21468)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dsimw501_GD21468 (Dsim_GD21468)
Transfer RNA biogenesis [BR:dsi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dsimw501_GD21468 (Dsim_GD21468)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 306 aa AA seqDB search
MAATAPVIMRVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIAS
LAKKFPTVKIIGEEGGSDLNVCDDWLVNELDEGFLQQSCPAEWKDVKPEDFVIWVDPLDG
TAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAVP
APAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKIPAEVR
AAVGAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaactgctccagtgataatgcgcgtcatggcgtcctcgatcagcaccgccaag
cgggctggcggcataatccgcgacgtgctcaagaagggcgacctgggcatagtggacaag
ggaaagaacgatccgcagacggaggcagatcgctctgcccagcgctgcatcatcgcctcc
ttggccaaaaagttccccaccgtcaagatcattggcgaggaaggtggatccgatctgaat
gtctgcgacgactggctggtaaacgagttggatgagggattcctgcagcaaagttgccca
gctgagtggaaggatgtgaagcccgaagactttgtcatatgggtagatcccctggacggc
acagcggaatatacacagggacacgtagaacacgtgaccgtcctgatcggcatagccgtg
aaggatgctgctgtgggcggcatcattcatcagcccttctaccaacagcccgatggcgaa
atgggtcgcaccatttggggcctgaagggtctgggcacgggaggattcacggcggtgccc
gcgccagccggccagttcatcataaccaccactcgctcgcattccaatgccctgcatcaa
caagcactcaacgcattcgcatccacagaagttctgaaagtcggcggcgctgggttcaaa
gtgctccagctgctggagggaaaagcccacgcctacgtcttcgccacgccgggctgcaag
aagtgggacacctgcgcacccgaggccgttctggaggcccagggcggctgcctcaccaac
atcaacggcgagcactacgcctacaatgcggatgtggagcacgtgaatcgccagggagtg
ctggccagcctgggacaggaccatgccgcgctggtggaaaagattcccgccgaggtgcgg
gcggcagtgggagccaagtga

DBGET integrated database retrieval system