KEGG   Drosophila simulans: Dsim_GD21469Help
Entry
Dsim_GD21469      CDS       T01065                                 

Definition
GD21469 gene product from transcript GD21469-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dsi  Drosophila simulans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dsim_GD21469
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dsim_GD21469
Transfer RNA biogenesis [BR:dsi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dsim_GD21469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 138 aa AA seqDB search
KGLGTGGFTAVPAPAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGK
AHAYVFATPGCKKWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDH
AALVEKIPAEVRAAVGAK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
aagggtctgggcacgggaggattcacggcggtgcccgcgccagccggccagttcatcata
accaccactcgctcgcattccaatgccctgcatcaacaagcactcaacgcattcgcatcc
acagaagttctgaaagtcggcggcgctgggttcaaagtgctccagctgctggagggaaaa
gcccacgcctacgtcttcgccacgccgggctgcaagaagtgggacacctgcgcacccgag
gccgttctggaggcccagggcggctgcctcaccaacatcaacggcgagcactacgcctac
aatgcggatgtggagcacgtgaatcgccagggagtgctggccagcctgggacaggaccat
gccgcgctggtggaaaagattcccgccgaggtgcgggcggcagtgggagccaagtga

DBGET integrated database retrieval system