KEGG   Drosophila simulans: Dsim_GD21469Help
Entry
Dsim_GD21469      CDS       T01065                                 

Definition
GD21469 gene product from transcript GD21469-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dsi  Drosophila simulans
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dsi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 138 aa AA seqDB search
KGLGTGGFTAVPAPAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGK
AHAYVFATPGCKKWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDH
AALVEKIPAEVRAAVGAK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
aagggtctgggcacgggaggattcacggcggtgcccgcgccagccggccagttcatcata
accaccactcgctcgcattccaatgccctgcatcaacaagcactcaacgcattcgcatcc
acagaagttctgaaagtcggcggcgctgggttcaaagtgctccagctgctggagggaaaa
gcccacgcctacgtcttcgccacgccgggctgcaagaagtgggacacctgcgcacccgag
gccgttctggaggcccagggcggctgcctcaccaacatcaacggcgagcactacgcctac
aatgcggatgtggagcacgtgaatcgccagggagtgctggccagcctgggacaggaccat
gccgcgctggtggaaaagattcccgccgaggtgcgggcggcagtgggagccaagtga

DBGET integrated database retrieval system