KEGG   Drosophila simulans: Dsim_GD21635Help
Entry
Dsim_GD21635      CDS       T01065                                 

Definition
GD21635 gene product from transcript GD21635-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dsi  Drosophila simulans
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsim_GD21635
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dsim_GD21635
    2.7.1.82  ethanolamine kinase
     Dsim_GD21635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 520 aa AA seqDB search
MATNLQKATLEEIRHAAARICRDYLTGPWKVVTPENLVVKRISGGLSNFLYYVSLPDLND
YDELEEHQENVNVSEDFIGATATVTNRSRGFTHDDESAAKAVGVTLMARELINNEDVADA
APSAIQAYKRQRCDSDYRDSSSSKRLHTFKQEPREVLLRIYGQTHGDHALESMITESVVF
ALLSERNYGPKLHGIFPGGRIEQYIPARALITAELGEQRILKRVAEKMGEIHSLNIPMSK
EPDWIWNCMQRWVSGLESIVNGSVKTNPKSSVLKKQMELMRTFDYVQEMAWIRSIIEDGD
YPVVFCHNDLQEGNILMRQPTGQNERTPRESISSLRSNFDETLGDSLDGNSNISDTETHK
SHCASPSPCPELDTTNDSALDASFIADNEPDLIIIDFEYCAYNYRGYDLANHFIEWTFDY
TNPKFPYFYHNPSNCATVQQRRDFIVNYLKKYHDDENYNITGQELIKVDAEIQFFTMLSH
LFWSLWSVINVTSAIEFGYWEYGIARILEYQKLKAAYQAN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaacctgcaaaaggccactcttgaggaaattcgacatgcggccgcccgtatt
tgccgagactatctaactgggccctggaaagtggttactccagagaatttagtggtgaag
cgcataagtggcgggctgtcaaatttcttgtattacgtaagccttcccgatttaaatgac
tacgatgagctggaggagcaccaggaaaatgtcaacgtaagcgaagacttcataggggcc
accgcaactgtgaccaatagaagcaggggtttcacacacgacgatgagtcggctgccaag
gcggtgggcgtaacattgatggcgagggaattaataaataacgaggacgtagctgacgca
gctcctagcgccatacaagcatacaaacgtcagcgatgcgatagtgattatcgcgactcc
agttcttcgaaacgattgcacaccttcaagcaggaaccccgtgaggtccttctgcgaatc
tatggtcagacccatggtgatcacgcgctggagagcatgattaccgagtccgtggttttc
gcacttctcagtgaacggaactatgggcccaaactgcacggaatctttccgggcggacgc
attgaacaatacattccggcgcgcgcattgatcacagcagaattgggagagcaacgaata
ttaaagagagtggctgagaaaatgggtgagatccacagtctcaatatacccatgtctaag
gagcccgattggatttggaattgtatgcagcgttgggtttccggtttagagagcattgtt
aacggcagtgtcaaaacgaatccaaaatcttcggtactaaaaaaacaaatggaattgatg
cggacttttgactacgttcaagagatggcctggattaggtcgattatcgaagatggagat
tatccagttgtgttctgtcacaatgatctgcaagaaggtaatattctgatgcgacaaccg
acaggccaaaacgaacggaccccccgggagtctatcagtagcctgagatcaaacttcgac
gaaactttgggtgatagccttgatggaaatagcaatatatcggatacggagacacacaaa
tcacattgtgcgtcgccttcaccatgcccggagttggacactacgaatgactcagccctg
gatgccagcttcatagccgataatgagccggatcttattatcatcgactttgagtattgt
gcctacaactaccgtggctatgatctagccaatcattttattgagtggactttcgactac
accaacccaaagttcccttacttctaccacaaccccagcaactgcgcaactgttcagcaa
cggcgcgacttcattgtaaactatttaaagaagtatcacgatgacgagaactataatatc
actggtcaggagttgataaaggtagacgctgagattcagttctttacaatgctgtctcat
ctgttctggagcctttggtccgtaattaatgtcacatcggcgattgagtttggttattgg
gaatatggtattgctcgaattttggaatatcaaaagctaaaggcagcttatcaagctaat
taa

DBGET integrated database retrieval system