KEGG   Drosophila simulans: Dsimw501_GD21635Help
Entry
Dsimw501_GD21635  CDS       T01065                                 

Gene name
Dsim_GD21635
Definition
(RefSeq) GD21635 gene product from transcript GD21635-RA
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dsi  Drosophila simulans
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsimw501_GD21635 (Dsim_GD21635)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dsimw501_GD21635 (Dsim_GD21635)
    2.7.1.82  ethanolamine kinase
     Dsimw501_GD21635 (Dsim_GD21635)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 522 aa AA seqDB search
MTMATNLQKATLEEIRHAAARICRDYLTGPWKVVTPENLVVKRISGGLSNFLYYVSLPDL
NDYDELEEHQENVNVSEDFIGATATVTNRSRGFTHDDESAAKAVGVTLMARELINNEDVA
DAAPSAIQAYKRQRCDSDYRDSSSSKRLHTFKQEPREVLLRIYGQTHGDHALESMITESV
VFALLSERNYGPKLHGIFPGGRIEQYIPARALITAELGEQRILKRVAEKMGEIHSLNIPM
SKEPDWIWNCMQRWVSGLESIVNGSVKTNPKSSVLKKQMELMRTFDYVQEMAWIRSIIED
GDYPVVFCHNDLQEGNILMRQPTGQNERTPRESISSLRSNFDETLGDSLDGNSNISDTET
HKSHCASPSPCPELDTTNDSALDASFIADNEPDLIIIDFEYCAYNYRGYDLANHFIEWTF
DYTNPKFPYFYHNPSNCATVQQRRDFIVNYLKKYHDDENYNITGQELIKVDAEIQFFTML
SHLFWSLWSVINVTSAIEFGYWEYGIARILEYQKLKAAYQAN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggccaccaacctgcaaaaggccactcttgaggaaattcgacatgcggccgcc
cgtatttgccgagactatctaactgggccctggaaagtggttactccagagaatttagtg
gtgaagcgcataagtggcgggctgtcaaatttcttgtattacgtaagccttcccgattta
aatgactacgatgagctggaggagcaccaggaaaatgtcaacgtaagcgaagacttcata
ggggccaccgcaactgtgaccaatagaagcaggggtttcacacacgacgatgagtcggct
gccaaggcggtgggcgtaacattgatggcgagggaattaataaataacgaggacgtagct
gacgcagctcctagcgccatacaagcatacaaacgtcagcgatgcgatagtgattatcgc
gactccagttcttcgaaacgattgcacaccttcaagcaggaaccccgtgaggtccttctg
cgaatctatggtcagacccatggtgatcacgcgctggagagcatgattaccgagtccgtg
gttttcgcacttctcagtgaacggaactatgggcccaaactgcacggaatctttccgggc
ggacgcattgaacaatacattccggcgcgcgcattgatcacagcagaattgggagagcaa
cgaatattaaagagagtggctgagaaaatgggtgagatccacagtctcaatatacccatg
tctaaggagcccgattggatttggaattgtatgcagcgttgggtttccggtttagagagc
attgttaacggcagtgtcaaaacgaatccaaaatcttcggtactaaaaaaacaaatggaa
ttgatgcggacttttgactacgttcaagagatggcctggattaggtcgattatcgaagat
ggagattatccagttgtgttctgtcacaatgatctgcaagaaggtaatattctgatgcga
caaccgacaggccaaaacgaacggaccccccgggagtctatcagtagcctgagatcaaac
ttcgacgaaactttgggtgatagccttgatggaaatagcaatatatcggatacggagaca
cacaaatcacattgtgcgtcgccttcaccatgcccggagttggacactacgaatgactca
gccctggatgccagcttcatagccgataatgagccggatcttattatcatcgactttgag
tattgtgcctacaactaccgtggctatgatctagccaatcattttattgagtggactttc
gactacaccaacccaaagttcccttacttctaccacaaccccagcaactgcgcaactgtt
cagcaacggcgcgacttcattgtaaactatttaaagaagtatcacgatgacgagaactat
aatatcactggtcaggagttgataaaggtagacgctgagattcagttctttacaatgctg
tctcatctgttctggagcctttggtccgtaattaatgtcacatcggcgattgagtttggt
tattgggaatatggtattgctcgaattttggaatatcaaaagctaaaggcagcttatcaa
gctaattaa

DBGET integrated database retrieval system