KEGG   Drosophila simulans: Dsim_GD21666Help
Entry
Dsim_GD21666      CDS       T01065                                 

Definition
(RefSeq) GD21666 gene product from transcript GD21666-RA
  KO
K10739  
replication factor A2
Organism
dsi  Drosophila simulans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dsim_GD21666
   03420 Nucleotide excision repair
    Dsim_GD21666
   03430 Mismatch repair
    Dsim_GD21666
   03440 Homologous recombination
    Dsim_GD21666
   03460 Fanconi anemia pathway
    Dsim_GD21666
DNA replication proteins [BR:dsi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dsim_GD21666
DNA repair and recombination proteins [BR:dsi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dsim_GD21666
   MMR (mismatch exicision repair)
     Dsim_GD21666
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dsim_GD21666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 246 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLDPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcatttggagatttcaatgccacacaaactgcgcccgctggagccgccagc
aatcaaaagggagaaggaatagtgcccctggtggtgaagcagattgtggacgccccggag
ggaaacatcgagttgttcggcatgcagtacgccatggcctgtgttgtggccatagtgcga
aacgtggagacttcctcaacgaagatcacctatacactggaggaccatagcggcaggatc
gatgcgcactactggctggaggagggcgacgctctcaaggcacccgaggtcatggtcaac
aactacgtgaaggtctacggcaccacccggtcgcaaggcggttccaaaaccctaatgata
ttcaagctactgcccgtcttggatcccaacgaggtgtgcacgcacctgctggaagtactc
aatgcccgctacagggccgaggactaccagagcaagggtggagctggagctggtgcaggc
gcttcttccggctcaggctccatagctgatttcaccgcctcccagagctcggccattgtt
agtgggctagatcccaagcagcaggccgtcttccaggccatcaagagcaatgtttccgaa
gagggcatctctcgcaaggaactgaaagccaaattctcccacatcagcgattctgagttg
accaacattctggactttatgatttccgagggacacatttattccagcattgacgcagat
cactttatttgcacaatgtaa

DBGET integrated database retrieval system