KEGG   Drosophila simulans: Dsim_GD21666Help
Entry
Dsim_GD21666      CDS       T01065                                 

Definition
GD21666 gene product from transcript GD21666-RA
Orthology
K10739  
replication factor A2
Organism
dsi  Drosophila simulans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dsim_GD21666
   03420 Nucleotide excision repair
    Dsim_GD21666
   03430 Mismatch repair
    Dsim_GD21666
   03440 Homologous recombination
    Dsim_GD21666
   03460 Fanconi anemia pathway
    Dsim_GD21666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 246 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLDPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcatttggagatttcaatgccacacaaactgcgcccgctggagccgccagc
aatcaaaagggagaaggaatagtgcccctggtggtgaagcagattgtggacgccccggag
ggaaacatcgagttgttcggcatgcagtacgccatggcctgtgttgtggccatagtgcga
aacgtggagacttcctcaacgaagatcacctatacactggaggaccatagcggcaggatc
gatgcgcactactggctggaggagggcgacgctctcaaggcacccgaggtcatggtcaac
aactacgtgaaggtctacggcaccacccggtcgcaaggcggttccaaaaccctaatgata
ttcaagctactgcccgtcttggatcccaacgaggtgtgcacgcacctgctggaagtactc
aatgcccgctacagggccgaggactaccagagcaagggtggagctggagctggtgcaggc
gcttcttccggctcaggctccatagctgatttcaccgcctcccagagctcggccattgtt
agtgggctagatcccaagcagcaggccgtcttccaggccatcaagagcaatgtttccgaa
gagggcatctctcgcaaggaactgaaagccaaattctcccacatcagcgattctgagttg
accaacattctggactttatgatttccgagggacacatttattccagcattgacgcagat
cactttatttgcacaatgtaa

DBGET integrated database retrieval system