KEGG   Drosophila simulans: Dsim_GD21702Help
Entry
Dsim_GD21702      CDS       T01065                                 

Definition
GD21702 gene product from transcript GD21702-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dsi  Drosophila simulans
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dsi00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dsi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 391 aa AA seqDB search
MSTIIFQGHPASWYPYCIAVPGDGGSHIDARLNKPNSPYLICQKTHDWYNLWLDLEQLVI
PMVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGDPEVVEWIDPTKNSAGAYFKDIANE
LVKLGYIRRQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLM
TLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITH
PSTAWLLPSPLFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFNP
PNVELHCLYGDGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSNAP
INTLALQNVDHMHILSNPDVLKYIRTVMQQP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattatctttcaagggcatccagcttcatggtatccctattgtattgcagta
cccggcgacggaggctcacatatagatgctcggctaaataagcccaactctccctactta
atttgccaaaagacccacgactggtacaacctgtggcttgacctggagcagttggtcatc
cccatggtctactgttggatagacaatgtcaagctgtactacgacaaggtcaccaggacc
acacacaacactcctggtgtggagacgaggatacccggctggggcgatcccgaggtggtc
gagtggatcgatcccaccaagaacagcgccggagcctacttcaaggatatagccaatgag
ctggtgaaacttggatatattcgcagacaaaacatccacggagcaccctatgacttccgc
aaagcgccaaatgagaaccaacagttcttcatcgatctcaagcagctggtggaggactcc
tatgaggccaacaatcagtcggctgtgaccttcatctcgcacagcatgggcagtctcatg
accctggtcttcttgcaggagcaaaccctccaatggaaggcgaaatacgtgaagcgcatg
atcagcctggcgggagtttgggcgggaagttttaaggctgtgaaggtgtttgccatgggc
gatgatctcgactcgttcgccctgagtgccaagatcctcaaggcggaacagataacacac
ccatccacggcctggttgctgccctcgccactgttttggaagccatccgaggttctggcc
atgaccccaagcagaaactatacgatggcacagctggaagagttcttcaaagacctcgac
tacatgacgggctgggaaatgcgcaaggacacgattcggtacaaccgaaacttcaatcca
ccgaatgtggaactgcactgtctctatggcgatggcatcgacacggtcgagagactgcag
tacaagaaatcggacattagtggagaaactcccaagctgataatgggtctcggcgacggc
actgtcaaccagcgttctctgcgagcctgcaagtattgggccggctattccaatgcgcct
ataaacacgctggccctccagaacgtggaccacatgcacatcctgtccaatccggacgtc
ctcaaatatatccgcactgtcatgcagcagccgtaa

DBGET integrated database retrieval system