KEGG   Drosophila simulans: Dsimw501_GD21702Help
Entry
Dsimw501_GD21702  CDS       T01065                                 

Gene name
Dsim_GD21702
Definition
(RefSeq) GD21702 gene product from transcript GD21702-RB
  KO
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dsi  Drosophila simulans
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsimw501_GD21702 (Dsim_GD21702)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsimw501_GD21702 (Dsim_GD21702)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dsimw501_GD21702 (Dsim_GD21702)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2L
AA seq 421 aa AA seqDB search
MRLKSGVLSVLLLTTFLALGDCFWPFSKWHGTNDNPSVPPEPKLSPVIFVPGDGGSQMDA
RLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETR
IPGWGDPEVVEWIDPTKNSAGAYFKDIANELVKLGYIRRQNIHGAPYDFRKAPNENQQFF
IDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGS
FKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPSRNYTMA
QLEEFFKDLDYMTGWEMRKDTIRYNRNFNPPNVELHCLYGDGIDTVERLQYKKSDISGET
PKLIMGLGDGTVNQRSLRACKYWAGYSNAPINTLALQNVDHMHILSNPDVLKYIRTVMQQ
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaaatccggagtgctttctgtgctcctgctgaccaccttcttggccctgggc
gactgcttttggccatttagcaaatggcatggaacaaatgataatccttctgtgccccct
gaacccaagctgtcgccagtgatattcgtacccggcgacggaggctcccaaatggatgct
cggctaaataagcccaactctccctacttaatttgccaaaagacccacgactggtacaac
ctgtggcttgacctggagcagttggtcatccccatggtctactgttggatagacaatgtc
aagctgtactacgacaaggtcaccaggaccacacacaacactcctggtgtggagacgagg
atacccggctggggcgatcccgaggtggtcgagtggatcgatcccaccaagaacagcgcc
ggagcctacttcaaggatatagccaatgagctggtgaaacttggatatattcgcagacaa
aacatccacggagcaccctatgacttccgcaaagcgccaaatgagaaccaacagttcttc
atcgatctcaagcagctggtggaggactcctatgaggccaacaatcagtcggctgtgacc
ttcatctcgcacagcatgggcagtctcatgaccctggtcttcttgcaggagcaaaccctc
caatggaaggcgaaatacgtgaagcgcatgatcagcctggcgggagtttgggcgggaagt
tttaaggctgtgaaggtgtttgccatgggcgatgatctcgactcgttcgccctgagtgcc
aagatcctcaaggcggaacagataacacacccatccacggcctggttgctgccctcgcca
ctgttttggaagccatccgaggttctggccatgaccccaagcagaaactatacgatggca
cagctggaagagttcttcaaagacctcgactacatgacgggctgggaaatgcgcaaggac
acgattcggtacaaccgaaacttcaatccaccgaatgtggaactgcactgtctctatggc
gatggcatcgacacggtcgagagactgcagtacaagaaatcggacattagtggagaaact
cccaagctgataatgggtctcggcgacggcactgtcaaccagcgttctctgcgagcctgc
aagtattgggccggctattccaatgcgcctataaacacgctggccctccagaacgtggac
cacatgcacatcctgtccaatccggacgtcctcaaatatatccgcactgtcatgcagcag
ccgtaa

DBGET integrated database retrieval system