KEGG   Drosophila simulans: Dsim_GD21714Help
Entry
Dsim_GD21714      CDS       T01065                                 

Definition
GD21714 gene product from transcript GD21714-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dsi  Drosophila simulans
Brite
Ribosome [BR:dsi03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dsim_GD21714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 204 aa AA seqDB search
MLPIARGIYSGLANITRNSRGALHTASALRCKAETSTEENDAAANEGEGEDNAGGSAPDP
KDRSKAIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
ITYDVPFREYDYNEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgattgcacgtgggatttacagtggactggccaacattaccaggaatagtcgg
ggagctcttcacacggccagcgccttgagatgcaaggcggagacttcgactgaagaaaat
gatgcggctgccaacgagggcgaaggcgaggataacgctggtggttccgcgccggacccg
aaggatcgcagcaaggctataccggtggagacctcgattcgatacttgaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacacgcaagacgtgcatccgccagaaccgcatcagcaccgga
aacccctgtcccatttgccgtgatgagtacctggtgctggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgtcctcagctactcaaagacaggcctg
tgtcaaaagagccacctacgtctaatggtcgccgttcagcaagcccgcgactccggctac
attacatacgatgtgcccttcagggagtatgattacaacgagtactacggccaggagcag
aagcagaaagcttaa

DBGET integrated database retrieval system