KEGG   Drosophila simulans: Dsim_GD21855Help
Entry
Dsim_GD21855      CDS       T01065                                 

Definition
GD21855 gene product from transcript GD21855-RA
Orthology
K11252  
histone H2B
Organism
dsi  Drosophila simulans
Brite
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsim_GD21855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Un
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaccgacaagaaaaagaagcgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggaatttcgtcgaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgaattgctgccgaagcgtctcgtctagctcac
tacaacaagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgcctgcttctg
cctggagagttggccaagcatgctgtcagtgagggaaccaaggccgttaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system