KEGG   Drosophila simulans: Dsim_GD22014Help
Entry
Dsim_GD22014      CDS       T01065                                 

Definition
GD22014 gene product from transcript GD22014-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dsim_GD22014
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   Dsim_GD22014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 720 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLTGSRLDLPQLCNGSRRLDGHNNHVAANETTVTTTSLNG
NGNGNGNSNNNNNIGSPVSSSTTNSSNGGNERGSSTKSNSSSGSGSSGNSASSTGSGELK
CNTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDD
NGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVE
LNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIR
RFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSR
FYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLI
SVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLEWDPAER
MTPDEAAHHEFLQPSSSSRHRSCRMSSSSSSSGLNSVSQKSSCYSFSEISPGTNGPVVAS
ITSTTAVHNAAIATTTKSRQQPPSQSHGHAQSNGHLPDIKLSASDKYNSMQKVAVRSKIT
SSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLPGTGSGIVGAMSSKYGSSTLAH
NHHNVTHHNASTATIATTTHHHHHHGGQQQQQSSSGASTMAMSHSQSTGDVSDRAIFGRA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgcgaaatgccgatccagctggacaacgagaagttgcggcgggatgtt
cgactgacgggctctcgactggatttgccacaactctgtaatggatcccgtcggttggat
ggccacaacaaccatgtggctgccaatgagaccacggttacgacgacatccctgaatgga
aatgggaacggcaatggcaacagcaacaacaacaacaacatcggatcgcccgtctcctca
tcgacaacaaacagcagtaatggcggcaacgagcgcggctcctccacaaagtccaatagc
agcagtggaagtggcagctcgggaaattcggccagcagcacgggaagtggcgagctcaag
tgcaatacgcccatgacgccatctgagctggtgaagaagttccgcaactacctaaccgat
cttgagtttgaagagctcaaggtgtacaaggaggtgtggtattttggccagcacgccagc
aagaactacaacaaacccgcccccacagccaataccacaaatctgggctatgacgatgat
aatggcaactacaagatcatcgaacacgatcacatagcctttcgttacgagattctggag
gtaattggcaagggcagttttggccaggtcatcagggcgctggatcacaagaccaacaca
cacgtggccatcaagatcataaggaacaagaagcgcttcctcaaccaggccgtcgtcgaa
ctgaatatcctcgatgagctgcgcgaaaaggacgcggatggatctcacaatgtcatacac
atgctcgactatacctatttccgcaagcatttgtgtattaccttcgagctaatgagcttg
aacctgtacgaattgataaagaagaacaactacaatggattcagcatgagtctcatacga
cgcttttgcaactcgattgtgaagtgcctgcgtttgctctataaggaaaacattattcac
tgtgatctcaagccggaaaatatcttgctcaaacagcgtggtagcagctccattaaagtc
atcgactttggcagctcatgctacgtggatcgcaaaatctatacgtacatccaatcaagg
ttctatcgctccccagaggtgattctcggcctgcaatacggcacagccatcgatatgtgg
agcttgggctgcattctggcggagctgtacacaggattcccgctcttccccggcgaaaac
gaagttgagcagttagcctgcatcatggaggtgctcggtctgccgcccaaggtgctcata
tcggttgccaggcgacgtcggctgttctttgattcccgtgatgccccgcgctgcataact
aacaccaagggacgcaaacggtcgccaggcagcaagtcgttggcacatatcttgcactgc
caggaccgctatttcatcgacttcctgcagcgttgcttggagtgggatcctgcggagcgg
atgacgccggacgaggcggcccaccacgagtttctgcagccctcttcctccagtcgccat
cgcagctgccgcatgtcgagcagttcgtccagttccggactcaacagtgtttcccagaag
tcctcctgctacagcttttcggagatctcgccgggcaccaacggtcccgtggtggcctcg
attaccagcaccacggcggtgcataatgccgcgattgccaccacaaccaagtcgagacag
cagccgccatctcagagtcacggccatgcccaatcgaatggacacctgcccgacatcaag
ttgagtgccagcgacaagtacaacagcatgcagaaggtggcggtgcgctcgaagatcacg
tccagcgtctcggatctggagtccgtgcagcagtactccctgcaccgcatctacggagga
gtgggtagtggcagcacacaccatgtctcgtcagcggccaccaggaaacatctgcccggt
acaggcagtggaattgtgggtgccatgtcttccaaatacggcagctcaacgttggcgcac
aaccatcacaatgtgacgcaccacaatgcatcgacggccaccattgccacgaccacgcac
caccatcaccaccatggtgggcaacagcaacagcagtcgtcgtcgggagcatccaccatg
gccatgtcgcactcacagtccactggagatgtctcagacagggccatctttgggagagct
tga

DBGET integrated database retrieval system