KEGG   Drosophila simulans: Dsimw501_GD22065Help
Entry
Dsimw501_GD22065  CDS       T01065                                 

Gene name
Dsim_GD22065
Definition
(RefSeq) GD22065 gene product from transcript GD22065-RA
  KO
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dsimw501_GD22065 (Dsim_GD22065)
Chaperones and folding catalysts [BR:dsi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dsimw501_GD22065 (Dsim_GD22065)
Membrane trafficking [BR:dsi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dsimw501_GD22065 (Dsim_GD22065)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2L
AA seq 510 aa AA seqDB search
MWITGQFVFLLLVALVAAKTKTSAVQDDIAEYKDFKKLLRTKNNVLALYVTSAKSAAAEL
KIFREAAEAIRGTGTMLLLDCGQQDRKKLCKKLKVSPDPYAIKHYKDGDFHKDYDRQLSV
SSMITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPDYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGEN
NKDALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFE
VNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDDDNFTSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLK
TKLDYNGGRTSKDFIAYMNNPPTSADRTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcaccggtcagtttgtttttcttctgctggtggcacttgttgccgcaaaaacg
aaaacctcggcggtgcaggatgacatcgcagagtataaggacttcaagaagctgctgcgc
accaagaacaatgtcctcgcgctatacgtgaccagtgcgaagtccgctgctgccgagcta
aagatattccgtgaggcggcggaggcgatacggggaaccgggacaatgttgctgctggat
tgcggccagcaggatcgcaagaaactgtgcaagaagctgaaagtatcgccggacccctac
gccattaaacactacaaggatggcgactttcacaaggactacgaccggcagctgagcgtc
agctccatgatcactttcatgcgtgatccctccggcgatctgccctgggaggaggatcca
gccggcaaggatgttctgcacttcagcgacgccgcttccttcacaaagcatttacgcaag
gacatccggcccatgcttgtcatgttctatgttccctggtgcggattctgcaagaaaatg
aagccggactacggaaaagcgtctacggagctaaaaactaagggcggttatattctggca
gcaatgaatgtagagcgacaggagaacgctcctatacgcaaaatgttcaacataactggt
tttcccaccctgatttactttgaaaatggcaagctgcgctttacatacgaaggagagaac
aataaggacgctttggtttcttttatgctcaacccaaatgccaagccaacgccaaagccc
aaggaacccgaatggtcggcggataccaactcggagattgtccatctcacttcgcagggt
tttgagcccgctctgaaggacgagaagtccgccctggtcatgttctatgcaccctggtgt
ggacactgtaagcgcatgaagccggaatacgaaaaggctgctctggagatgaagcagaaa
aagattcccggccttttggccgcgttggatgcaacgaaggagccgtcaatcgcagagaaa
tataaagtcaagggctatccaactgttaagtttttctcgaatggcgtctttaagtttgaa
gtaaatgtacgcgaagcatcgaaaattgttgaatttatgagagatcccaaggagccccca
ccgcctccgccgcccgagaagagttgggaggaggaggaggacagcaaggaagttctattt
ctggatgacgacaacttcacttctacgctgaagaggaaaaagcatgcgctggtcatgttc
tatgcaccctggtgtggacactgtaagcacacaaaaccggagttcacagcggctgccacg
gccttacaggatgatcctcggatagcgtttgtcgccatcgactgcacaaagcttgctgcg
ctctgcgcaaagtacaatgtacgcggatatcccaccattctgtacttctcttacctcaaa
accaagctggattacaatggcggacgtaccagcaaggactttatcgcctatatgaacaac
ccgcctacctcagcggaccgcacagagctgtga

DBGET integrated database retrieval system