KEGG   Drosophila simulans: Dsim_GD22275Help
Entry
Dsim_GD22275      CDS       T01065                                 

Definition
GD22275 gene product from transcript GD22275-RA
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dsim_GD22275
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsim_GD22275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 475 aa AA seqDB search
MPAFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNL
QIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPTNQEPSNTVQKRHSSFIDQFFGGTFEV
KMSSEEEPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIR
TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSK
FKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSS
GHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatttaaagttaaggtgaagtggggccgggagctctacacagatatcgttgta
aacaccgacgaggagccgattttgtttaaggcccagttgtttgccctgactggcgttcaa
ccggatcgccagaaagttatgtgcaagggcggcattctgaaggatgaccagtggaatctg
cagatcaaggacggcgctgtggtcctgttgctgggcagcaaggaaagtgttccagaagtg
cctgccactccggtcaaattcattgaggacatgaacgaagctgaggcagccacagcgatg
cgtctaccggctgggctgacaaatctgggcaatacgtgctacatgaacgccactgtccag
tgcctgaacgcagtgcccgagctccgcactgccctgagcactttcagtaacgatggaacc
gacaccatgtcgaccgcattttccatatcatctgccatgaagtctatatttgctcaaatg
gagaagggcacaactgtgacgccaattgtgctgctgcaggcattgcaccgggcatcaccg
caatttgcccagactggcgaaaatggcacatacaggcagcaggacgccaatgagtgctgg
gcagagatactgaaaatgttgcagcaaaagctgcggccaacaaaccaggaaccatcgaat
actgtccagaagaggcacagctcgtttatcgaccagttttttggtggcacttttgaagtt
aagatgagctctgaagaggaacccgatgaaccttcaacagtaacaagcgaaaatttcttg
cagttaagttgcttcatttccatggatgttaagtacatgcagagcggtctgaaatctaaa
atgaaagagcagctggtgaaaaaatctgaaaccctgggacgcgatgcaaagtacattcga
acttacttggtgagccgacttccagcctatctcaccgtacaatttgtgcgctttcaatac
aaaggaaaggagggcataaatgccaaggtgttgaaggatatcaaattccccattgacttc
gatgcctttgagttgtgtacccccgaattgcaaaacaagctctgcccaatgcgctcaaaa
ttcaaggatctggaagacaagaaaatggaagttgacgttgtgaaacgcaatgaacccaac
gaagagaagaaggacgttaagtacgagcagttctggttcgacgacgacttgggcagcaac
aattcgggatactatacgctgcaggcggtgctcacgcacaagggacgctccagttcgtcg
ggtcattatgtggcctgggttcgctccagcggcgatgtgtggttcaagttcgatgatgat
gaggtctccgccgtggccactgacgagatcttgcggctttccggcggcggagactggcat
tgcgcttatgtcctgttatatgcgcccagacgtttggagaaactataa

  All links  
No link information was found.   
DBGET integrated database retrieval system