KEGG   Drosophila simulans: Dsim_GD22283Help
Entry
Dsim_GD22283      CDS       T01065                                 

Definition
GD22283 gene product from transcript GD22283-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 639 aa AA seqDB search
MNSKPDYEAEKEKKLTITNRFGDSLENYEVSNESEHKTHVYPKKIPNRKNGILKNTDVNH
SAVDNQHLEDVDLADILGTNWPKRAGPAAMILNNKSKTDPSNSEDLILKPASPILKIEPE
EPLRFTIADYQPLIEIPGTELAIGSLVEVSNPGLCEDLYGVVRWIGIPPGPQKNVLVGIE
VEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNTISANRVSSNH
AKKFGVAECPAIYGSIPPLEIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSVF
DSILYRRPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTC
EEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSS
DIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRD
CFGSLQAGSGLECTAFCPKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMEL
FAVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLSEEG
ARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMYH
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaacccgattatgaagcagaaaaagaaaaaaagctgaccataacaaataga
ttcggggattccctggaaaactatgaagtatccaacgagagcgagcacaagacccatgtt
tacccaaaaaagattcctaacagaaaaaacggaattttaaaaaacaccgatgtcaaccat
agtgccgtcgataatcagcatcttgaggatgtggacttggcagacattttgggcacaaat
tggccaaaacgagcgggaccagctgcaatgatcttaaacaacaaaagtaaaacggatcct
agtaattctgaagacttaattttaaaaccagcctctccaatattaaaaatagagccagag
gaacctttacgttttacaatcgctgattaccaacctctaattgaaatacctggtaccgag
ctagcgattggttccctcgtcgaagtctcaaatcctggactatgtgaagatctatatggc
gttgtaagatggataggtataccgcctggccctcaaaaaaacgtactcgtcggaatcgag
gtagaagacgaatccaacttgaaaaatgttgtggcatcggatgggagacacaatggcgta
cgcttatttacttgccatgatggtcgagctatttttgtaccagccaacagatgcaccgct
gaccggcgatttgctgatgtagataataccatttctgcaaacagagtttctagtaatcac
gcaaagaaatttggtgtcgctgagtgtcctgccatttatggttcgataccgccattagaa
atacacaattccgatgagcttgcaagcatatgtggaaagtttaaaggaatacaaggacac
cataattcctgctaccttgatgcaactctattttccatgttcactttcaccagtgttttc
gattcaattctgtacagacgtccgggcccacaagatattcgaaattacagtgaggttcag
aaggttctgcgcgatgagatcgtcaatccattgcgaaaaaacgttttcgttcgatccgat
cgtgtgatgaaactgcgcgagctcctagatcagctaagttcggtcagcggtctcacctgc
gaggaaaaggatcctgaagagttcctaaatagtttgctctcacaaattatgcgagttgaa
ccgtttctaaagctaagctcgggacaagattcttatttttaccaactatttgtggagaag
gatgagaagttaacattaccgagtgtgcagcaactgtttgagcaaagcttccactcatcg
gatataaaactaaaggaggttccttcttgtttcatcatacaaatgcctcgtttcggaaag
aactacaagatgtatccaaggatattgccatctcaggttctcgatgtcacagacataatt
gaaaattctcctcgacagtgctcactttgtggcaaactagctgaatacgagtgccgggat
tgctttggcagcttgcaggctggatcaggactggagtgcaccgccttttgtccaaaatgt
ctcaagacatttcacagtcacatcaaaagaacgaatcatgtgtcgaagaagatttatagt
ccgaaggaatttaaaatcatggcggagcacatggttgtcccgcgattgtacatggagtta
ttcgcagtcgtttgcatagaaacatctcactacgtggcatttgtcaagtctggatccgga
cctgatgctccatggtgtttcttcgattcaatggctgatcgaaaaggcgaacagaatgga
tacaatatacctgaaattacgtgtgttccagaattaacacagtggctctcggaagaaggc
gcacgatctataaatgaaacttcaacgaacgataaagtattacctgaacacgccaagcgt
attttttgcgatgcctatatgtgtctgtaccaaagcacagatataatgatgtaccattag

DBGET integrated database retrieval system