KEGG   Drosophila simulans: Dsimw501_GD22283Help
Entry
Dsimw501_GD22283  CDS       T01065                                 

Gene name
Dsim_GD22283
Definition
(RefSeq) GD22283 gene product from transcript GD22283-RB (EC:3.4.19.12)
  KO
K08601  
ubiquitin thioesterase [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsimw501_GD22283 (Dsim_GD22283)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsimw501_GD22283 (Dsim_GD22283)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C67
   Dsimw501_GD22283 (Dsim_GD22283)
Ubiquitin system [BR:dsi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dsimw501_GD22283 (Dsim_GD22283)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 639 aa AA seqDB search
MNSKPDYEAEKEKKLTITNRFGDSLENYEVSNESEHKTHVYPKKIPNRKNGILKNTDVNH
SAVDNQHLEDVDLADILGTNWPKRAGPAAMILNNKSKTDPSNSEDLILKPASPILKIEPE
EPLRFTIADYQPLIEIPGTELAIGSLVEVSNPGLCEDLYGVVRWIGIPPGPQKNVLVGIE
VEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNTISANRVSSNH
AKKFGVAECPAIYGSIPPLEIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSVF
DSILYRRPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTC
EEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSS
DIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRD
CFGSLQAGSGLECTAFCPKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMEL
FAVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLSEEG
ARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMYH
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaacccgattatgaagcagaaaaagaaaaaaagctgaccataacaaataga
ttcggggattccctggaaaactatgaagtatccaacgagagcgagcacaagacccatgtt
tacccaaaaaagattcctaacagaaaaaacggaattttaaaaaacaccgatgtcaaccat
agtgccgtcgataatcagcatcttgaggatgtggacttggcagacattttgggcacaaat
tggccaaaacgagcgggaccagctgcaatgatcttaaacaacaaaagtaaaacggatcct
agtaattctgaagacttaattttaaaaccagcctctccaatattaaaaatagagccagag
gaacctttacgttttacaatcgctgattaccaacctctaattgaaatacctggtaccgag
ctagcgattggttccctcgtcgaagtctcaaatcctggactatgtgaagatctatatggc
gttgtaagatggataggtataccgcctggccctcaaaaaaacgtactcgtcggaatcgag
gtagaagacgaatccaacttgaaaaatgttgtggcatcggatgggagacacaatggcgta
cgcttatttacttgccatgatggtcgagctatttttgtaccagccaacagatgcaccgct
gaccggcgatttgctgatgtagataataccatttctgcaaacagagtttctagtaatcac
gcaaagaaatttggtgtcgctgagtgtcctgccatttatggttcgataccgccattagaa
atacacaattccgatgagcttgcaagcatatgtggaaagtttaaaggaatacaaggacac
cataattcctgctaccttgatgcaactctattttccatgttcactttcaccagtgttttc
gattcaattctgtacagacgtccgggcccacaagatattcgaaattacagtgaggttcag
aaggttctgcgcgatgagatcgtcaatccattgcgaaaaaacgttttcgttcgatccgat
cgtgtgatgaaactgcgcgagctcctagatcagctaagttcggtcagcggtctcacctgc
gaggaaaaggatcctgaagagttcctaaatagtttgctctcacaaattatgcgagttgaa
ccgtttctaaagctaagctcgggacaagattcttatttttaccaactatttgtggagaag
gatgagaagttaacattaccgagtgtgcagcaactgtttgagcaaagcttccactcatcg
gatataaaactaaaggaggttccttcttgtttcatcatacaaatgcctcgtttcggaaag
aactacaagatgtatccaaggatattgccatctcaggttctcgatgtcacagacataatt
gaaaattctcctcgacagtgctcactttgtggcaaactagctgaatacgagtgccgggat
tgctttggcagcttgcaggctggatcaggactggagtgcaccgccttttgtccaaaatgt
ctcaagacatttcacagtcacatcaaaagaacgaatcatgtgtcgaagaagatttatagt
ccgaaggaatttaaaatcatggcggagcacatggttgtcccgcgattgtacatggagtta
ttcgcagtcgtttgcatagaaacatctcactacgtggcatttgtcaagtctggatccgga
cctgatgctccatggtgtttcttcgattcaatggctgatcgaaaaggcgaacagaatgga
tacaatatacctgaaattacgtgtgttccagaattaacacagtggctctcggaagaaggc
gcacgatctataaatgaaacttcaacgaacgataaagtattacctgaacacgccaagcgt
attttttgcgatgcctatatgtgtctgtaccaaagcacagatataatgatgtaccattag

DBGET integrated database retrieval system