KEGG   Drosophila simulans: Dsimw501_GD22289Help
Entry
Dsimw501_GD22289  CDS       T01065                                 

Gene name
Dsim_GD22289
Definition
(RefSeq) GD22289 gene product from transcript GD22289-RA (EC:2.7.11.24)
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dsi  Drosophila simulans
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis - fly
Apoptosis - multiple species
Wnt signaling pathway
Hippo signaling pathway - fly
Toll and Imd signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsimw501_GD22289 (Dsim_GD22289)
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsimw501_GD22289 (Dsim_GD22289)
   04310 Wnt signaling pathway
    Dsimw501_GD22289 (Dsim_GD22289)
   04391 Hippo signaling pathway -fly
    Dsimw501_GD22289 (Dsim_GD22289)
   04068 FoxO signaling pathway
    Dsimw501_GD22289 (Dsim_GD22289)
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD22289 (Dsim_GD22289)
   04215 Apoptosis - multiple species
    Dsimw501_GD22289 (Dsim_GD22289)
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dsimw501_GD22289 (Dsim_GD22289)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dsimw501_GD22289 (Dsim_GD22289)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsimw501_GD22289 (Dsim_GD22289)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dsimw501_GD22289 (Dsim_GD22289)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 372 aa AA seqDB search
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcagcaccagcactacaccgtcgaggtgggagacaccaacttcaccatc
cacagtcggtacattaacctacgacccataggatcaggtgcccaaggaatagtatgcgcc
gcttacgatactatcacccagcaaaatgtggcgattaagaaactatctcgaccattccaa
aatgtaacccatgccaagcgagcatatagggaattcaagctaatgaagcttgttaaccat
aaaaacattattggcttacttaatgcttttacgccgcaaaggaacttggaggagtttcag
gatgtctacctggtcatggagctgatggacgctaatctctgccaggtcatccaaatggac
ctggatcacgacagaatgtcctatttgctttatcaaatgttgtgcggaataaaacattta
cactcagcaggaattattcacagagacttaaagccatccaatatagttgtaaaggccgac
tgcactctaaaaattttggatttcggtctggcacgtactgcaggaactaccttcatgatg
actccctatgtggtcacccgatattacagggctccagaggtcattttgggcatgggatac
acagagaacgtggacatatggtccgtcggttgcatcatgggcgaaatgatacggggcggt
gtgctgtttcctggaacggatcatatagatcagtggaataaaattattgagcaattaggt
acaccatctccctcatttatgcagcggttacagccaaccgtccgaaactatgtggaaaat
cgtcctagatacactggatactcatttgatagacttttccccgatggcttgtttccaaat
gataataatcagaatagccgccggaaggcttctgacgctagaaatcttcttagtaaaatg
ctagtcattgatccagagcagcggatatctgtggacgaggctttgaagcatgaatatatc
aacgtgtggtatgatgctgaggaagtggatgctcccgctccggagccatatgatcacagc
gtggacgagagggaacacactgtggagcagtggaaggagctaatctatgaggaagtcatg
gactacgaagcacacaacacaaataatagaacgcggtag

DBGET integrated database retrieval system