KEGG   Drosophila simulans: Dsim_GD22290Help
Entry
Dsim_GD22290      CDS       T01065                                 

Definition
GD22290 gene product from transcript GD22290-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsim_GD22290
   04150 mTOR signaling pathway
    Dsim_GD22290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 224 aa AA seqDB search
MASISDDGMALSGYLKKLKTMKKKFFLLYEETSTSSARLEYYDTEKKFLQRAEPKRVIYL
KNCFNINRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHS
PYDQVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTT
IRRCGHASPTNVYSTWNSAAKVSWDLVICGWRRIMQLLLLICTT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatatcggatgacggcatggcgttgagtggctacctcaagaagctgaagacc
atgaagaagaagttctttttgctgtacgaggagacgagcacttcatcagcccggctggag
tactacgataccgaaaagaagttcctgcaaagagccgagccaaaaagggttatctatctg
aagaattgcttcaacatcaatcgccgcttggacaccaagcatagatttgtcattgtgctc
tcctccagagacggtggattcggcatcgttctggagaacgaaaatgatctacgcaaatgg
ctggacaaactactagttctgcaaaggaacatagccaattcgaatggaacagcgcactca
ccttatgaccaagtttggcaagttgtcattcaaaagaagggtatttcggagaaagttgga
atcaccggaacctaccactgttgccttacttcaaaatccctgacattcgtgtgcattgga
ccggagaagacgcccaatggcgaggatcgcgttgcgagcattgaaatacttttgaccacg
atcaggcgatgcggtcatgcatcccccaccaatgtatattctacgtggaactcggccgcc
aaagtgtcttgggatctggtgatctgtggatggagacggataatgcagctgttgctacta
atatgcacaacatga

DBGET integrated database retrieval system