KEGG   Drosophila simulans: Dsim_GD22290Help
Entry
Dsim_GD22290      CDS       T01065                                 

Definition
GD22290 gene product from transcript GD22290-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dsi04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dsi04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 224 aa AA seqDB search
MASISDDGMALSGYLKKLKTMKKKFFLLYEETSTSSARLEYYDTEKKFLQRAEPKRVIYL
KNCFNINRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHS
PYDQVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTT
IRRCGHASPTNVYSTWNSAAKVSWDLVICGWRRIMQLLLLICTT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatatcggatgacggcatggcgttgagtggctacctcaagaagctgaagacc
atgaagaagaagttctttttgctgtacgaggagacgagcacttcatcagcccggctggag
tactacgataccgaaaagaagttcctgcaaagagccgagccaaaaagggttatctatctg
aagaattgcttcaacatcaatcgccgcttggacaccaagcatagatttgtcattgtgctc
tcctccagagacggtggattcggcatcgttctggagaacgaaaatgatctacgcaaatgg
ctggacaaactactagttctgcaaaggaacatagccaattcgaatggaacagcgcactca
ccttatgaccaagtttggcaagttgtcattcaaaagaagggtatttcggagaaagttgga
atcaccggaacctaccactgttgccttacttcaaaatccctgacattcgtgtgcattgga
ccggagaagacgcccaatggcgaggatcgcgttgcgagcattgaaatacttttgaccacg
atcaggcgatgcggtcatgcatcccccaccaatgtatattctacgtggaactcggccgcc
aaagtgtcttgggatctggtgatctgtggatggagacggataatgcagctgttgctacta
atatgcacaacatga

DBGET integrated database retrieval system