KEGG   Drosophila simulans: Dsimw501_GD22290Help
Entry
Dsimw501_GD22290  CDS       T01065                                 

Gene name
Dsim_GD22290
Definition
(RefSeq) GD22290 gene product from transcript GD22290-RC
  KO
K16172  
insulin receptor substrate 1
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Autophagy - animal
mTOR signaling pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsimw501_GD22290 (Dsim_GD22290)
   04150 mTOR signaling pathway
    Dsimw501_GD22290 (Dsim_GD22290)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dsimw501_GD22290 (Dsim_GD22290)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dsimw501_GD22290 (Dsim_GD22290)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2L
AA seq 964 aa AA seqDB search
MASISDDGMALSGYLKKLKTMKKKFFVLYEETSTSSARLEYYDTEKKFLQRAEPKRVIYL
KNCFNINRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHS
PYDQVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTT
IRRCGHASPQCIFYVELGRQSVLGSGDLWMETDNAAVATNMHNMILSAMSAKTESNTNLI
NVYQNRPDLSHEPMRKRSSSANEASKPINVNVIQNSQNSLELRSCSSPHNYGFGRERCDS
LPTRNGTLSESSNQTYFGSNHGLRSNTISGIRPHSTNKHSNSPTFTMPLRCSESEESSIS
VDESDDNGSFSHYRLNTRTSETAIPEENIDDFVSAEFSKVTEPNESDENYIPMNPVNPTD
AIHEKEKADLQRLEDASLHFNFPEHASEKLAKDFDLDSDNQCCRPIRAYSIGNKVEHLKF
NKRLGHLNDTGQNPNRVRAYSVGSKSKIPRCDLQRVVLVEDNKHEFASNRSQSSIGKEGS
SYGSSANRQKKSTSAPLLSLKNQINSDRMSDLMEIDFSQATNLEKQKFIKNNEIPKYIEN
VFPKAPRTDSSSLTLHATSQKDIFNGGKLNNTAITSEDGYLEMKPVGNGYTPSSNCLPIK
VEKLKLSDYQTTAPPLLTATAAPVQDLNKISTYNISAEKWREQPSRSEEKKSNSPLTDNP
FSLKPTNVESKSKSHDVHSANQIDCEKVCVQSDKLNNLTDKIVENNNLDIDGHEEKKLVH
SISSEDYTQIKDKANDFSKFNEAGYKILQIKSDSSLISSKLYQKGMHKDNLERSHRLTES
VNTIPDNATATAGSGSLTKFNINSAKPAADSRSTGTDPSTPQNILQIKDLNFPSRSSSRI
SQPELHYASLDLPHCSGQNPAKYLKRGSRESPPVSACPEDGNTYAKIDFDQSDSSSSSSN
IFNT
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatatcggatgacggcatggcgctgagtggctacctcaagaagctgaagacc
atgaagaagaagttctttgtgctgtacgaggagacgagcacttcatcagcccggctggag
tactacgataccgaaaagaagttcctgcaaagagccgagccaaaaagggttatctatctg
aagaattgcttcaacatcaatcgccgcttggacaccaagcatagatttgtcattgtgctc
tcctccagagacggtggattcggcatcgttctggagaacgaaaatgatctacgcaaatgg
ctggacaaactactagttctgcaaaggaacatagccaattcgaatggaacagcgcactca
ccttatgaccaagtttggcaagttgtcattcaaaagaagggtatttcggagaaagttgga
atcaccggaacctaccactgttgccttacttcaaaatccctgacattcgtgtgcattgga
ccggagaagacgcccaatggcgaggatcgcgttgcgagcattgaaatacttttgaccacg
atcaggcgatgcggtcatgcatccccacaatgtatattctacgtggaactcggccgccaa
agtgtcttgggatctggtgatctgtggatggagacggataatgcagctgttgctactaat
atgcacaacatgatactgagcgctatgtcagccaaaacagagtcgaacacgaatttaata
aacgtttatcagaacagacctgacttaagtcacgagcccatgagaaagcgatcgtcgtca
gcaaacgaagcttcgaagccgataaacgtaaacgtcatacaaaatagtcaaaactctctc
gaattgcgcagctgcagttcgccccataactatggttttggcagagagagatgcgatagc
ttaccaaccagaaatggaacccttagcgagtccagcaatcaaacgtactttggttccaac
catggactgcgatccaatactatatctggcatccgtccgcactcaaccaacaagcatagt
aatagtccaacgttcaccatgccattgagatgctcagaatccgaagagtcatcaattagt
gtcgatgaatccgacgacaacggcagttttagccactacagattaaacacgcggacatcg
gagacggctattcccgaggaaaacattgatgactttgtcagtgcggagtttagcaaagtc
accgaaccaaatgaaagtgacgaaaactacataccgatgaatccagtcaatcctactgat
gctatccatgaaaaggagaaggctgacctgcagagattggaagacgcttctctgcatttc
aactttccggagcacgcgtcggaaaaacttgctaaggattttgatctggactctgataac
caatgctgtcgtcccattcgcgcctattcgataggcaacaaggttgagcatttaaagttt
aataagcgcctgggccacttgaatgatacgggacagaatccgaatcgcgtgagagcctac
tcggtgggttccaagtcgaagataccgcgctgcgacctgcagcgagtggtcctcgtggag
gacaataaacatgagttcgcgtcgaataggagtcagagtagcattggcaaggagggatcc
agctatggcagcagtgccaatcggcaaaagaagtccacaagtgctccactgctcagtctg
aagaaccagataaactccgaccgaatgagcgacttaatggaaattgacttttcacaagca
accaatttggaaaagcagaagttcatcaagaacaatgaaattccgaaatacattgaaaac
gtgttcccaaaagccccccgaacggatagctccagcctaactctgcacgccacaagtcag
aaggacattttcaatggcggcaaactgaataacacagcgatcacatccgaggatggctac
ctcgagatgaagccagtcggtaatggatacactcccagttcgaattgccttccaatcaaa
gtggagaagctcaagctatcagactatcagactaccgcaccgccactcctcaccgcaaca
gccgcaccagtgcaggatctaaacaaaattagcacatacaatatatccgctgagaaatgg
agagagcagcccagcagaagcgaggagaagaagtcgaactcgccactgactgacaacccc
ttcagcttgaaacccacaaatgtagagagtaaaagcaaaagccatgatgtgcattcagca
aatcaaatcgattgcgagaaggtgtgcgtgcagagcgataagctaaataatctgacggac
aagattgtcgagaacaacaatttggatatagacgggcatgaggaaaagaagttggttcat
tcgataagcagcgaagactacacacaaatcaaggacaaagcgaatgatttcagcaaattt
aacgaggccggctacaaaattctgcaaattaaaagcgacagctcactcatctcatcgaag
ctataccaaaagggtatgcacaaggataacctggagcgttcgcatagacttacggagagt
gtgaatacgattccggataatgccaccgccaccgccggcagcggctcactcaccaaattc
aatataaattcagcaaagccagccgccgattcgcgcagcactggcacagatccaagcaca
ccacagaacattctacagattaaggatttgaatttcccctcacggtcgtcgtctcgcata
tcccagccggagctgcactacgccagcctagatcttccccactgcagcggccaaaatcca
gctaaatacctgaagagaggatcacgcgaatcgccgccggtgtccgcgtgcccggaggat
gggaatacctatgcgaaaatcgactttgaccaatccgactcctcttcctcctcatcgaac
atatttaatacgtaa

DBGET integrated database retrieval system