KEGG   Drosophila simulans: Dsimw501_GD22305Help
Entry
Dsimw501_GD22305  CDS       T01065                                 

Gene name
Dsim_GD22305
Definition
(RefSeq) GD22305 gene product from transcript GD22305-RA
  KO
K11252  
histone H2B
Organism
dsi  Drosophila simulans
Brite
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dsimw501_GD22305 (Dsim_GD22305)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsimw501_GD22305 (Dsim_GD22305)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaatatc
accaagaccgacaagaaaaagaagcgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggcatttcatctaaggcgatgagcatcatg
aacagctttgtaaatgatattttcgagcgcattgctgccgaggcgtctcgtctggctcac
tacaacaagcgctcgaccatcaccagtcgagaaatccaaacggctgttcgcctgcttctg
ccgggagagttggccaagcatgctgtcagtgagggaaccaaggctgtcaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system