KEGG   Drosophila simulans: Dsimw501_GD22345Help
Entry
Dsimw501_GD22345  CDS       T01065                                 

Gene name
Dsim_GD22345
Definition
(RefSeq) GD22345 gene product from transcript GD22345-RA (EC:2.7.11.-)
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dsi  Drosophila simulans
Pathway
Longevity regulating pathway - multiple species
Wnt signaling pathway
Hedgehog signaling pathway - fly
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsimw501_GD22345 (Dsim_GD22345)
   04341 Hedgehog signaling pathway - Fly
    Dsimw501_GD22345 (Dsim_GD22345)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dsimw501_GD22345 (Dsim_GD22345)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dsimw501_GD22345 (Dsim_GD22345)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dsimw501_GD22345 (Dsim_GD22345)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsimw501_GD22345 (Dsim_GD22345)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dsimw501_GD22345 (Dsim_GD22345)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 353 aa AA seqDB search
MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataacgccaccacgtcaaacaagaaggtcgatgccgccgagacggtgaaggag
ttcctcgagcaggccaaggaggagttcgaggacaagtggcgacgcaatccgaccaacacc
gccgccctcgatgacttcgaacggatcaagaccctgggcaccggctcctttggccgtgtc
atgatcgtccagcacaagcccacgaaagactattatgccatgaagatcctcgacaagcag
aaggtggtcaagctgaagcaggtggagcacacgctgaacgagaagcgaatcctgcaggcc
attcagttccccttcctcgtctcgctgcgctaccacttcaaggacaactccaacctctac
atggtgctggagtatgttcccggtggcgagatgttctcccacctgcgcaaggtgggccgc
ttctcggagccgcactcgcgcttctacgcggcgcaaatcgtgctggccttcgagtacctg
cactacttggacctcatctaccgcgatctgaagccggagaatctgctgattgactcgcag
ggctacctcaaggtgacggacttcggttttgccaagcgggtcaagggccgcacctggacg
ctgtgcggcacgcccgaatacctggccccggagatcattctgtccaagggctataacaag
gccgtcgactggtgggcgttgggcgtactcgtctacgaaatggccgctggctatccgccg
ttctttgcggatcagccgatccagatctacgagaagatcgtctccggcaaggtgcgcttc
ccatcgcactttggctccgatctgaaggacctactgcgcaacctgctgcaggtggatctg
accaagcgctacggcaatctgaaggcgggcgtcaatgatattaagaaccagaagtggttc
gcctccaccgactggattgcgatcttccaaaagaaaatcgaggcgccgttcattccgcgg
tgtaagggtcccggcgacacgagcaatttcgatgactacgaggaggaggcgctgcggatc
tccagcaccgagaagtgtgccaaggagtttgctgaattctag

DBGET integrated database retrieval system