KEGG   Drosophila simulans: Dsim_GD22345Help
Entry
Dsim_GD22345      CDS       T01065                                 

Definition
GD22345 gene product from transcript GD22345-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dsi  Drosophila simulans
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dsi04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:dsi04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 353 aa AA seqDB search
MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataacgccaccacgtcaaacaagaaggtcgatgccgccgagacggtgaaggag
ttcctcgagcaggccaaggaggagttcgaggacaagtggcgacgcaatccgaccaacacc
gccgccctcgatgacttcgaacggatcaagaccctgggcaccggctcctttggccgtgtc
atgatcgtccagcacaagcccacgaaagactattatgccatgaagatcctcgacaagcag
aaggtggtcaagctgaagcaggtggagcacacgctgaacgagaagcgaatcctgcaggcc
attcagttccccttcctcgtctcgctgcgctaccacttcaaggacaactccaacctctac
atggtgctggagtatgttcccggtggcgagatgttctcccacctgcgcaaggtgggccgc
ttctcggagccgcactcgcgcttctacgcggcgcaaatcgtgctggccttcgagtacctg
cactacttggacctcatctaccgcgatctgaagccggagaatctgctgattgactcgcag
ggctacctcaaggtgacggacttcggttttgccaagcgggtcaagggccgcacctggacg
ctgtgcggcacgcccgaatacctggccccggagatcattctgtccaagggctataacaag
gccgtcgactggtgggcgttgggcgtactcgtctacgaaatggccgctggctatccgccg
ttctttgcggatcagccgatccagatctacgagaagatcgtctccggcaaggtgcgcttc
ccatcgcactttggctccgatctgaaggacctactgcgcaacctgctgcaggtggatctg
accaagcgctacggcaatctgaaggcgggcgtcaatgatattaagaaccagaagtggttc
gcctccaccgactggattgcgatcttccaaaagaaaatcgaggcgccgttcattccgcgg
tgtaagggtcccggcgacacgagcaatttcgatgactacgaggaggaggcgctgcggatc
tccagcaccgagaagtgtgccaaggagtttgctgaattctag

DBGET integrated database retrieval system