KEGG   Drosophila simulans: Dsimw501_GD22345Help
Entry
Dsimw501_GD22345  CDS       T01065                                 

Gene name
Dsim_GD22345
Definition
(RefSeq) GD22345 gene product from transcript GD22345-RA (EC:2.7.11.-)
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 353 aa AA seqDB search
MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataacgccaccacgtcaaacaagaaggtcgatgccgccgagacggtgaaggag
ttcctcgagcaggccaaggaggagttcgaggacaagtggcgacgcaatccgaccaacacc
gccgccctcgatgacttcgaacggatcaagaccctgggcaccggctcctttggccgtgtc
atgatcgtccagcacaagcccacgaaagactattatgccatgaagatcctcgacaagcag
aaggtggtcaagctgaagcaggtggagcacacgctgaacgagaagcgaatcctgcaggcc
attcagttccccttcctcgtctcgctgcgctaccacttcaaggacaactccaacctctac
atggtgctggagtatgttcccggtggcgagatgttctcccacctgcgcaaggtgggccgc
ttctcggagccgcactcgcgcttctacgcggcgcaaatcgtgctggccttcgagtacctg
cactacttggacctcatctaccgcgatctgaagccggagaatctgctgattgactcgcag
ggctacctcaaggtgacggacttcggttttgccaagcgggtcaagggccgcacctggacg
ctgtgcggcacgcccgaatacctggccccggagatcattctgtccaagggctataacaag
gccgtcgactggtgggcgttgggcgtactcgtctacgaaatggccgctggctatccgccg
ttctttgcggatcagccgatccagatctacgagaagatcgtctccggcaaggtgcgcttc
ccatcgcactttggctccgatctgaaggacctactgcgcaacctgctgcaggtggatctg
accaagcgctacggcaatctgaaggcgggcgtcaatgatattaagaaccagaagtggttc
gcctccaccgactggattgcgatcttccaaaagaaaatcgaggcgccgttcattccgcgg
tgtaagggtcccggcgacacgagcaatttcgatgactacgaggaggaggcgctgcggatc
tccagcaccgagaagtgtgccaaggagtttgctgaattctag

DBGET integrated database retrieval system