KEGG   Drosophila simulans: Dsim_GD22351Help
Entry
Dsim_GD22351      CDS       T01065                                 

Definition
GD22351 gene product from transcript GD22351-RA
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dsi  Drosophila simulans
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:dsi01200]
Metabolism; Overview; Fatty acid metabolism [PATH:dsi01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dsi00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dsi00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dsi00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dsi00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dsi01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dsi00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dsi00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:dsi00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dsi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 783 aa AA seqDB search
MSATRFLSAVGQISRQQLLQNKCTRALPISAQLLQSRRLMSTNPAPVANKHLHTKVVNGV
LVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEA
CQTADEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKL
GLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGL
QPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTARK
QVLKASNGLYPAPLKILDVIRAGVDKGTDAGYEAERKGFGELSATPESKGLIALFRGQTE
CKKNRFGKPERPVKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGL
ETAVKRKRISGLERDQTLASLRPTLDYSDFKNADIIIEAVFEDIKVKHRVIKELEAVVPE
HCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTIAQAVAV
GLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLLQEGVDPKDLDQYTKKFGFPVGAATLA
DEVGIDVGSHIAVDLAKAFGERFSGGNLEVMNDLVLAGFLGRKSGKGIFLYDGQKRGTRP
VNNDALEIVKQKYALVSKGANAPEDLTLRMVSRFINEAVLCLEEKILDSPLEGDVGAVFG
LGFPPFSGGPFRWVDQYGAGKLVSKMQSYAELYGAPFKPAQTLLDMAKDPAKKFYPKTGS
SKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaacgaggtttctgagtgccgttggccaaatttcgcgacagcaattgttgcag
aataagtgcacaagagccctgcccatttcggcccagctcctccagagccgccgcctaatg
tccacgaatcccgcaccggttgccaacaagcatctccacaccaaggtggtcaatggagtg
ctagtgatcaagatcgactcacccaatgccaaggtgaattccctgggctccgaggttagc
gatgagttcgagcgagtgatcaaggacctggagacgaatcctgccgtcaattccgccgtt
ctgatttcgggcaaaccgggctgctttgtggccggtgccgacatcgggatgctggaagcg
tgccagacggcggatgaggccacgctgatctcccacggcgcccaggtgatgttcgatcgc
atggagcgcagcaagaagcccattgtggccgccatcagcggagtctgtctgggtggtggt
ctagaactcgcccttgcctgccattaccgcattgccaccaaggacagcaagaccaaactg
ggtctgcccgaggtcatgcttggtctcctgcccggcggcggtggcacagtccgcctgccc
aagcttacctccgtgcccacggctctggatatggagctgaccggcaaacaggtgcgcgcc
gatcgcgccaagcgactgggcatcgtggatctgttggtggatcccctaggtccaggactc
cagcctgctgagcagaacaccatcgagtacctggagaagaccgccgtgcaggtcgccaac
gatctggccagtggcaaacttcgcgttaatcgcgagaaaagcggtctggtcagcaagatc
cagtccttcgtcatggacaccgactttgtgaagaacaaaatcttcgacactgccaggaag
caggtgctcaaggcctcgaacggtctctatcccgctcccctgaagattctcgatgtgatc
cgtgctggcgtggataagggaaccgatgccggttacgaggcggagcgcaagggcttcggt
gagctgtcggccacgcccgagtccaagggtttgattgccctgttccgtggacaaacggag
tgcaagaagaaccgatttggcaagccagagcgtccggttaagactgtgggtgtgctggga
gctggtctgatgggcgccggaatcgtacaggtctccgtcgataagggatatcaggtggtg
atgaaggatgccaccgaagccggcctggctcgtggtattggacaagtgcagaagggtttg
gagacggctgtgaagcgcaagcgcatctctggactggagcgcgatcagactcttgccagt
ctgcggcccactcttgattacagcgacttcaagaacgcggacatcatcatcgaagctgtg
ttcgaggacatcaaggttaagcaccgtgtgatcaaggagctggaagcagtggttccagag
cactgcgtcattgccaccaacaccagcgccattcccatcaccaagatcgctgcaggaagc
tcgcgtcccgagaaggtcgttggcatgcactacttctcgcccgtggacaagatgcagctg
ctggaaatcatcacccacccaggcacctccaaggataccatcgcccaggccgtggccgtc
ggactcaagcaaggcaaggtcgttatcactgttggtgacggacctggcttctataccacc
cgcatcctctccaccatgctgtcggaagccatcagactgctgcaggaaggcgtggacccc
aaggatctggaccaatacacgaagaaatttggtttccccgtgggtgctgcgacccttgcg
gatgaggttggcattgacgtgggttcccacattgccgtcgacttggcaaaggctttcggc
gaacgcttcagcggtggaaacttggaagtgatgaacgatctggtcctggctggtttcctc
ggacgcaagtccggcaagggtatcttcctgtacgatggccagaagaggggcactcgtcca
gtgaacaacgatgccctcgaaatcgtgaaacagaagtacgctttagtctcaaagggagcc
aatgcccccgaggatctgacgctgcgtatggtgtcccgcttcatcaacgaagccgtgctc
tgtctggaggagaagattctggacagtccgctggagggcgatgtcggagccgtttttgga
ctgggcttcccgccattctccggtggtcccttccgctgggtcgatcagtatggagcaggc
aaactggtcagcaagatgcaatcctatgctgagctgtacggagctcccttcaagcccgca
cagaccctgctcgacatggctaaggacccggcgaagaagttctaccccaagactggctcc
tcgaagttgtag

DBGET integrated database retrieval system