KEGG   Drosophila simulans: Dsim_GD22375Help
Entry
Dsim_GD22375      CDS       T01065                                 

Definition
GD22375 gene product from transcript GD22375-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dsi  Drosophila simulans
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dsim_GD22375
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dsim_GD22375
Glycosyltransferases [BR:dsi01003]
 Glycan extension
  Type 3 chain
   Dsim_GD22375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 388 aa AA seqDB search
MTANSLLGRSILNEGRSNKRSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDV
NDAHHSHDMMEMSGPDQDVGGHEHVHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVK
RTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKA
DDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEAL
PNPKLCKSDNSGAEDVEIGKCLQNVKVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFW
YWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINTPEALPNKLAVG
ELMPEIKEQVTESTSDGVSKRSAETKTQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaacagtttgctaggaaggtccatactcaatgaaggacgctcaaacaagcga
tcatttgtgtccctaattgtgggcctgatcgtgggcttctgcctggcggagctgttcgtc
tactccacgccggagcgaagtgaattcatgccatacgatggccatcggcacggcgacgtg
aacgatgcccatcacagccacgacatgatggagatgtccgggccggaccaggatgtgggt
gggcacgagcacgtgcacgagaactcgaccattgcggagcgactgtacagcgaggtgcgg
gtgctctgctggatcatgaccaatccgagcaaccatcagaagaaggcgcgccacgtgaag
cgcacctggggcaagcggtgcaacaagctgatcttcatgagctccgccaaggacgacgag
ctggacgcagtggctctgcccgtgggcgagggtcgcaacaacctgtggggcaagacgaag
gaggcctacaagtacatctacgagcatcacatcaacgacgccgactggttcctgaaggcc
gacgatgacacctacacgatagtggagaacatgcgttacatgctgtatccgtacagtccg
gaaactccagtctacttcggctgcaagttcaagccgtacgtgaagcaaggctacatgtcc
ggcggtgccggctacgttctcagccgggaggctgtgcgtcgctttgtggtcgaagccctg
cccaatccgaagctgtgcaagtcggataactcgggcgctgaggacgtggagattggcaaa
tgcctgcaaaatgtaaaggtgctcgctggggactcgcgagactcaaacggtcggggtcgc
ttctttccatttgtgcccgagcaccatctgatcccatcgcacacggacaagaagttctgg
tactggcagtacatcttctacaaaacggatgagggtcttgactgctgctcggacaacgcc
atatcgttccactacgtctcccccaaccaaatgtatgtgctggactatctgatctaccat
ctgcgaccgtacggtatcataaacacacccgaagcattgcccaataagctggccgtgggc
gaactgatgccggagatcaaggagcaggtgacggagagcacaagtgatggggtctccaag
agatccgccgagacaaagacgcaataa

DBGET integrated database retrieval system