KEGG   Drosophila simulans: Dsim_GD22617Help
Entry
Dsim_GD22617      CDS       T01065                                 

Gene name
Dsim_chic
Definition
(RefSeq) GD22617 gene product from transcript GD22617-RA
  KO
K05759  
profilin
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsim_GD22617 (Dsim_chic)
Cytoskeleton proteins [BR:dsi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dsim_GD22617 (Dsim_chic)
Exosome [BR:dsi04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dsim_GD22617 (Dsim_chic)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 142 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSNGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRRLPADRVLRSHCHIVALVHCCTLRPTRITTRLTHQPDLLERCLSVIVSIYEDP
VQPQQAASVVEKLGDYLITCGY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccaatggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggctttgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggcgccttccagctgatcgggtgcttcgttcgcactgccac
attgttgcattggtgcactgctgcaccttgcgccctactcgaattaccacccgactgacc
caccagccagatttgctggagcgttgcctatccgtgatcgtttccatctacgaggatccc
gttcagccccagcaggccgcttccgtggtagagaaacttggagattatctgattacttgc
gggtactag

DBGET integrated database retrieval system