KEGG   Drosophila simulans: Dsim_GD22617Help
Entry
Dsim_GD22617      CDS       T01065                                 

Gene name
Dsim_chic
Definition
GD22617 gene product from transcript GD22617-RA
Orthology
K05759  
profilin
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 142 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSNGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRRLPADRVLRSHCHIVALVHCCTLRPTRITTRLTHQPDLLERCLSVIVSIYEDP
VQPQQAASVVEKLGDYLITCGY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccaatggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggctttgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggcgccttccagctgatcgggtgcttcgttcgcactgccac
attgttgcattggtgcactgctgcaccttgcgccctactcgaattaccacccgactgacc
caccagccagatttgctggagcgttgcctatccgtgatcgtttccatctacgaggatccc
gttcagccccagcaggccgcttccgtggtagagaaacttggagattatctgattacttgc
gggtactag

DBGET integrated database retrieval system