KEGG   Drosophila simulans: Dsim_GD22775Help
Entry
Dsim_GD22775      CDS       T01065                                 

Definition
GD22775 gene product from transcript GD22775-RA
Orthology
K03968  
NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
dsi  Drosophila simulans
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Dsim_GD22775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 116 aa AA seqDB search
MSAVNDPLELLTNKGTHEPSFLSPIWNPLACGVAGVGVAIFVNWGFRRPVFSGIQKHIAF
GAVGVGAGAYFDQKRNEYLAKRDAVLRHYIELHPDDFPVKERKTYGQVLESWVPVR
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccgtgaacgatccgctggaacttttgacgaacaagggcacccacgagccttct
ttcctctcgccgatatggaatccgctggcctgcggagtggccggcgtgggcgtggccatt
ttcgtcaactggggcttccgtaggcccgtgttttccggcatccagaagcacatcgccttc
ggagctgtgggtgtcggcgcaggagcttacttcgatcagaagaggaacgagtacctggcc
aaaagggacgccgtcctccggcactacatcgaactgcatcccgacgatttcccggtgaag
gaacgcaagacctatggccaagtgctggagagttgggtgccagtgcgctaa

DBGET integrated database retrieval system