KEGG   Drosophila simulans: Dsim_GD22801Help
Entry
Dsim_GD22801      CDS       T01065                                 

Definition
GD22801 gene product from transcript GD22801-RA
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsim_GD22801
   00052 Galactose metabolism
    Dsim_GD22801
   00500 Starch and sucrose metabolism
    Dsim_GD22801
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsim_GD22801
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dsim_GD22801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 242 aa AA seqDB search
MFNIFIPLCGIFSQEILLHLFSAFTLISTLNSFEKWIFPETRPLWFLREQFANKVVVEKP
AVALESHQLSCEMTGGLPCAHSMTFTVFVLILASFFFVRCWDRSEAWRSPFCRCIMYFLI
IGMVVCMWLSRLYLATEFLHQCILGSYLGIRALSTFEGNVKYLFARPRRYAVSAVCFLGG
LALSVYYVKLELNIDPHWSVREAFKWCPEPTYLRHEVGPIFALVRDLGNLMGLALASPLY
KL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacatctttattccgctatgtggcatcttcagtcaggaaatcctactgcacctc
ttctcggcatttaccctgatcagcacactgaactccttcgaaaagtggatatttccggag
acgcgtcctttgtggtttctgcgagagcagtttgccaataaagtggttgtagaaaaaccg
gcggttgccttggaaagtcatcagctgagctgcgagatgaccggtggactgccctgcgcc
cactcaatgaccttcacggtgttcgtgctcatcctggcctcgttcttcttcgtccgctgc
tgggatcgctccgaggcctggcgctctcctttctgccgctgcataatgtacttcctgatc
attggaatggtggtatgtatgtggctgagtcgcctctacctggccaccgagtttctgcac
cagtgcatcctgggcagctacttgggcatcagggctctcagcaccttcgagggaaatgtg
aagtacttgttcgcgcgaccacgtcgctatgcggtctcagctgtttgcttcttgggagga
ttggcattgtcggtgtactatgtgaagctggaactcaatatcgatccccattggtcggtg
cgcgaggcgtttaaatggtgtccagaacccacatatttgcgtcatgaagttggtccaatc
tttgcacttgtcagagatctgggaaatctaatgggactggccttggcctcgccactatat
aagctgtaa

DBGET integrated database retrieval system