KEGG   Drosophila simulans: Dsimw501_GD22801Help
Entry
Dsimw501_GD22801  CDS       T01065                                 

Gene name
Dsim_GD22801
Definition
(RefSeq) GD22801 gene product from transcript GD22801-RA
  KO
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD22801 (Dsim_GD22801)
   00052 Galactose metabolism
    Dsimw501_GD22801 (Dsim_GD22801)
   00500 Starch and sucrose metabolism
    Dsimw501_GD22801 (Dsim_GD22801)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsimw501_GD22801 (Dsim_GD22801)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dsimw501_GD22801 (Dsim_GD22801)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 350 aa AA seqDB search
MESMVHIISEAYHKTLTRELFINEWAQERLSFGKPLWHFLSVQMEPNNMFNIFIPLCGIF
SQEILLHLFSAFTLISTLNSFEKWIFPETRPLWFLREQFANKVVVEKPAVALESHQLSCE
MTGGLPCAHSMTFTVFVLILASFFFVRCWDRSEAWRSPFCRCIMYFLIIGMVVCMWLSRL
YLATEFLHQCILGSYLGIRALSTFEGNVKYLFARPRRYAVSAVCFLGGLALSVYYVKLEL
NIDPHWSVREAFKWCPEPTYLRHEVGPIFALVRDLGNLMGLALASPLYKLEIKQSSFWRR
CRFLGVLEFVNYGLRLSTFKQSGRFVFLTYEFLRNAVHSLVLVKYVSNFY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgatggtgcacattatttcggaagcgtaccataaaacgctcacgcgggagctt
ttcatcaacgaatgggctcaggaacgcttgagttttggaaagcccctttggcattttctc
agcgttcagatggagccaaacaacatgttcaacatctttattccgctatgtggcatcttc
agtcaggaaatcctactgcacctcttctcggcatttaccctgatcagcacactgaactcc
ttcgaaaagtggatatttccggagacgcgtcctttgtggtttctgcgagagcagtttgcc
aataaagtggttgtagaaaaaccggcggttgccttggaaagtcatcagctgagctgcgag
atgaccggtggactgccctgcgcccactcaatgaccttcacggtgttcgtgctcatcctg
gcctcgttcttcttcgtccgctgctgggatcgctccgaggcctggcgctctcctttctgc
cgctgcataatgtacttcctgatcattggaatggtggtatgtatgtggctgagtcgcctc
tacctggccaccgagtttctgcaccagtgcatcctgggcagctacttgggcatcagggct
ctcagcaccttcgagggaaatgtgaagtacttgttcgcgcgaccacgtcgctatgcggtc
tcagctgtttgcttcttgggaggattggcattgtcggtgtactatgtgaagctggaactc
aatatcgatccccattggtcggtgcgcgaggcgtttaaatggtgtccagaacccacatat
ttgcgtcatgaagttggtccaatctttgcacttgtcagagatctgggaaatctaatggga
ctggccttggcctcgccactatataagctggaaattaaacaatcatcattttggcggcgt
tgccgattccttggcgtcctggagtttgtcaactatggattgcgcctttccacgtttaag
cagtctggtcgcttcgttttcttgacatatgagttcttaagaaatgccgttcattcccta
gtactggttaagtacgtatcgaatttttactag

DBGET integrated database retrieval system