KEGG   Drosophila simulans: Dsim_GD22801Help
Entry
Dsim_GD22801      CDS       T01065                                 

Definition
GD22801 gene product from transcript GD22801-RA
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dsi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dsi00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dsi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 242 aa AA seqDB search
MFNIFIPLCGIFSQEILLHLFSAFTLISTLNSFEKWIFPETRPLWFLREQFANKVVVEKP
AVALESHQLSCEMTGGLPCAHSMTFTVFVLILASFFFVRCWDRSEAWRSPFCRCIMYFLI
IGMVVCMWLSRLYLATEFLHQCILGSYLGIRALSTFEGNVKYLFARPRRYAVSAVCFLGG
LALSVYYVKLELNIDPHWSVREAFKWCPEPTYLRHEVGPIFALVRDLGNLMGLALASPLY
KL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacatctttattccgctatgtggcatcttcagtcaggaaatcctactgcacctc
ttctcggcatttaccctgatcagcacactgaactccttcgaaaagtggatatttccggag
acgcgtcctttgtggtttctgcgagagcagtttgccaataaagtggttgtagaaaaaccg
gcggttgccttggaaagtcatcagctgagctgcgagatgaccggtggactgccctgcgcc
cactcaatgaccttcacggtgttcgtgctcatcctggcctcgttcttcttcgtccgctgc
tgggatcgctccgaggcctggcgctctcctttctgccgctgcataatgtacttcctgatc
attggaatggtggtatgtatgtggctgagtcgcctctacctggccaccgagtttctgcac
cagtgcatcctgggcagctacttgggcatcagggctctcagcaccttcgagggaaatgtg
aagtacttgttcgcgcgaccacgtcgctatgcggtctcagctgtttgcttcttgggagga
ttggcattgtcggtgtactatgtgaagctggaactcaatatcgatccccattggtcggtg
cgcgaggcgtttaaatggtgtccagaacccacatatttgcgtcatgaagttggtccaatc
tttgcacttgtcagagatctgggaaatctaatgggactggccttggcctcgccactatat
aagctgtaa

DBGET integrated database retrieval system