KEGG   Drosophila simulans: Dsim_GD22942Help
Entry
Dsim_GD22942      CDS       T01065                                 

Definition
GD22942 gene product from transcript GD22942-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dsi  Drosophila simulans
Module
cGMP signaling
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dsim_GD22942
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dsim_GD22942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 768 aa AA seqDB search
MAAGKLTDREREAIVSNLTKDVQALREMVRSRESELVKLHREIHKLKSVLQQTTNNLNVT
RNEKAKKKLYSLPEQCGEQESRNQNPHLCSSCGMVMPTSPEFALEALSLGPLAPLPSTSS
ASSSGSTSADEVRPKAMPAAIKKQGVSAESCVQSMQQSYSIPIPKYDKDFSDKQQIKDAI
MDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSPAGEFAVMQQGKVLD
KMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLK
SVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTST
EETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKD
YGDESRMLAMKQARESCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQD
RVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACM
GGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVD
FGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPD
PMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGF
DWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccgctggaaagttgactgatcgggagcgggaggcgatcgtcagcaatctgaccaag
gacgtgcaggctctgagggaaatggtgcggagtcgggagagcgagctggtcaagctgcac
cgcgaaatccacaagctgaagagtgtgctccagcagaccaccaacaacctgaacgtcacc
cgaaatgaaaaggccaagaagaagctctactccttgccagagcaatgcggcgagcaggaa
agtaggaaccagaatccacatttgtgcagctcctgcggcatggtgatgcccaccagtccg
gagttcgccctggaggcgctttctctgggaccgctggcccccttaccatcaacatcttcc
gcctcctcatctggatcgacatctgcggatgaagtgcgacccaaggcgatgcccgctgcc
atcaagaaacaaggtgtatccgccgagagctgtgtgcagtccatgcagcaatcctacagc
ataccgattccaaaatacgacaaggatttcagtgataagcagcaaatcaaagacgccatc
atggacaatgacttcctaaagaacatagacgcatcgcaggtgcgggaactggtggattca
atgtactccaagagcatagcagccggcgagtttgtgatccgcgagggtgaggtgggcgca
catctgtacgtctcccccgccggcgagtttgcggtgatgcagcagggcaaggttctggac
aagatgggggcgggaaaggcgtttggggagctggctatcctctacaactgcaccaggacg
gcctccattcgagtcctaagtgaggctgcgagggtatgggtgctggacagacgtgtcttt
cagcagattatgatgtgcacgggcctccagcgaatcgaaaacagcgtgaacttcctaaaa
tccgtgcccctgctgatgaaccttagtgaggaactgctggccaagatagcagacgttctg
gagctggagttctacgccgctggcacctacatcatccgacaaggaaccgccggggacagt
ttcttcttgatctcacagggcaatgtccgcgtgacccaaaaactaactcccacctccacg
gaggaaacggagttgcgaacgctgtccaggggagactatttcggagagcaggcgctgatc
aacgaggataagcgaacggccaacatcatcgcactgtcaccaggagttgagtgcttgacc
ctggacagggattccttcaagcggctgattggggatctctgcgagctgaaggagaaggac
tacggcgatgagagcaggatgctagcgatgaagcaggcgcgggaaagctgccgggatgag
ccgaaggagcagctgcagcaggagttccccgatctcaagctcacggacctcgaggtggtc
agcactcttggcatcggaggctttggtcgggtggagctggtcaaggcccaccatcaagat
cgcgtggatatttttgccctgaagtgtctcaagaagcgacacattgtggacaccaaacag
gaggagcacatcttcagcgaacgccacatcatgctcagttcgaggtcgcccttcatctgc
cgtttgtaccgcaccttccgtgacgagaagtacgtgtatatgctgctcgaggcctgcatg
ggtggggagatatggacgatgctccgggatcgcggatccttcgaggacaacgcggcgcag
ttcatcatcgggtgtgtcctgcaggcgtttgagtacctgcatgcccgcggaatcatctat
agagaccttaagccggagaacctgatgctggatgagcgcggctatgtcaaaatcgtggac
ttcggcttcgccaagcagatcggaaccagctctaagacgtggaccttctgcggcacccct
gagtacgtggcacccgagatcatcctgaacaagggtcacgatcgagccgtagactactgg
gctttgggcattctcattcatgaactgctcaacggaacgccaccgttcagtgctccagat
cccatgcagacgtacaacctcatcctgaagggcattgacatgatagcctttccgaagcac
atctcccgctgggccgtgcagctcatcaagaggctatgccgcgatgtaccatcggagcgc
ctcggctaccagactggtggcatccaggacataaagaaacataagtggttcctgggattc
gactgggacggcttggccagccagctgctgattccgcccttcgtgagacccatcgcccat
cccacggatgtgcgctacttcgaccgctttccgtgcgatttgaacgagccaccggacgag
ctctccggctgggatgcggatttctag

DBGET integrated database retrieval system