KEGG   Drosophila simulans: Dsimw501_GD23017Help
Entry
Dsimw501_GD23017  CDS       T01065                                 

Gene name
Dsim_GD23017
Definition
(RefSeq) GD23017 gene product from transcript GD23017-RF
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dsi  Drosophila simulans
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsimw501_GD23017 (Dsim_GD23017)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsimw501_GD23017 (Dsim_GD23017)
   04070 Phosphatidylinositol signaling system
    Dsimw501_GD23017 (Dsim_GD23017)
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dsimw501_GD23017 (Dsim_GD23017)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dsimw501_GD23017 (Dsim_GD23017)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dsimw501_GD23017 (Dsim_GD23017)
Membrane trafficking [BR:dsi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    Dsimw501_GD23017 (Dsim_GD23017)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    Dsimw501_GD23017 (Dsim_GD23017)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2L
AA seq 1318 aa AA seqDB search
MMSAGGTYISTASVEVPQALQDGEKFIRWDDDSGTGTPVTMRVDAKGFFLYWVDQNNELD
ILDIATIRDVRTGQYAKRPKDNKLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCT
RRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSISVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRK
CMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRY
LMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCR
CVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQ
AKIANYCREIFGDMLLDKPLDSHPLEPNMDLPPPAMLRRKIIIKNKKKHHHHHHHHHHKK
PAQVGTPAANNKLTTANSVDAKAAQQVVLAAAHEDGGVTRGTANGDVATGTGTGSAAGTA
GHAPPLQQIRQSSKDSTGSSDSDSSSEDESLPNTTPNLPSGNEPPPEKAQKETEAGAEIS
ALVNYVQPIHFSSFENAEKKNRCYEMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAG
TRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRR
LDPFAESTVDGIIAGTVSITVLSGQFLTDKRANTFVEVDMYGLPADTVRKKFRTKTVRDN
GMNPLYDEEPFVFKKVVLPELASIRIAAYEEGGKLIGHRVLPVIGLCPGYRHVNLRSEVG
QPIALASLFLCVVVKDYVPDDLSNFAEALANPIKYQSELEKRDIQLSVLTDEAEALGSAD
EDLSKSFVFVQVGGQKKELRPVESLATSPKHRPSISAAAAMSVDVTVDRTDGGRGEDSVS
IVAPSIQHQHSLDQSVSTSIRQVESSQFDVDLVLAEPLEKILDHKSVKEKRLEMEKKLES
LRKKHDKEKVKIAGQKSSPLEGKKPKFAITNKLVKRLSNKSLNCLSPHSEPGIEIPACPL
DLGDSSEESAAADAGEDLAGGSSSLDGRTQESRLRSACREYTSQYRELQEKYHEAIYSAA
EKVLKTSQTGQTKQLKASLDKVTGEVMHQLQEARRNEVKNLATVHRDRDELIRMKREVAS
SVVERGVAERVRLKQTFDRRTDELQKQHDSVRNALAEHRSKARQILDKEAESRSCVSSNG
FLVLFHGPHHHGCSGSSSSALSGNNLTLNLDAGATASHSAISPARSHNSIAAAAEMKT
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgccggaggaacctacatctccaccgccagcgtggaggtgccacaagctctg
caagatggcgagaagttcattcgatgggatgatgactcgggcactggaacaccggttaca
atgcgcgtcgatgccaagggcttcttcctctactgggtcgaccagaacaacgagctggat
atccttgatatagccaccatacgcgacgttcgcacaggacagtacgcaaagcgaccaaag
gacaacaagctgcgccagattgtgacgctgggcccccaggacacgctcgaggagaagaca
gtgacggtatgccacggctcggacttcgtcaacatgacgttcgtcaacttctgctgcacc
cggcgggacatagcccagctctggaccgacggactcatcaagttggcctacagtttggcc
cagctcaatggctcggcgattatgttcctgcagaaggcccataccaaactgtgtctccag
gtggacaagagcggccgcataccagtgaaaaacatcataaaacttttcgcccaaaacaag
gaggatcgcaaacgtgtcgagaaggcgctggacgtgaccggtttgccgtcgggaaaggtc
gatagcatatcggtgtccaaatttcaattcgaggacttttacaatttgtacaaatatctc
acgcagcgttcggaggtggagcgcctctttgacagcattgttggcaactcgaagcgcaag
tgcatgtccatcgctcaactggtggagttcctgaacaagacgcagcgtgatccccgcctg
aacgagatcctctacccctatgcgaatcccgcccgcgccaaggagctcatccagcaatat
gagcccaacaagttcaatgcgcaaaagggccaactcagcctggatggctttttgaggtac
ttaatgggcgacgacaatcccatcatggcgcccagcaagctcgatctctgcgatgacatg
gaccagccgatgtcgcactacttcatcaactcctcgcacaacacctacttgacgggacac
cagctgaccggcaagtcgtccgtcgagatttacaggcagtgtctcctggcgggatgcaga
tgcgttgagctcgacttctggaacggacgcaccgaggagccagtcattgtccacggctat
acgttcgtgcccgagatatttgccaaggacgtgctggaggccatcgcagagagtgcattt
aaaacatccgaataccctgtgatattgagctttgagaatcactgcaaccctaggcaacag
gcgaaaattgccaactattgtcgcgaaatatttggcgatatgctgctcgataagccgctg
gactctcatccgctggaaccgaacatggacttgccaccgccggcgatgctgcgccgcaag
attataatcaagaacaagaagaagcatcaccaccaccatcaccatcatcaccacaaaaag
ccagcgcaggtgggcacgccggcagccaacaacaaactgactacagcgaattcagtggat
gccaaggcggcgcaacaagtcgttttggcggccgcgcatgaggatgggggcgtgaccagg
ggcaccgccaacggggacgttgccacgggaacaggaaccggaagtgctgctgggacagca
ggacacgcaccgccgttgcaacaaatccgccaaagctccaaagacagcactggatcctcc
gattcggacagctcttcggaggatgaatccctgcctaacaccacgcccaatttgcccagc
ggcaacgaacctccgccagaaaaggctcaaaaggaaacggaggccggagcagagatttca
gctttggtcaactatgttcagccgattcattttagctcttttgagaatgcagaaaaaaag
aatcggtgctacgaaatgtcttcgtttgatgaaaaacaggcgacaacactgttgaaggag
cgaccgattgagtttgtgaactataacaaacaccaattatctcgtgtctatccggcgggc
actcgctttgatagctccaactttatgccgcagttgttctggaatgccggatgtcagctt
gtggcacttaacttccaaaccctcgatctggccatgcaactcaatttggggatcttcgag
tataacgctcggtccggttatctacttaagccggagtttatgcgccgctcagatcgcaga
ttggatcccttcgcggaaagcactgtggatggcatcatagcaggcacagtatcaatcact
gttttatctggtcagtttctcacggataagagggcgaacacttttgtggaagtggatatg
tacggtttgccagcggacacggtgagaaagaagttccgcaccaaaacagtccgggataat
ggaatgaatccactttatgacgaggagccgttcgtgtttaagaaggtggttctccccgag
ttggcgagcattcgaattgcagcatatgaggagggtggcaaactcattggtcaccgcgtt
ttgcccgtaatcggtctgtgccctggttaccgacatgtaaatctccgatctgaagtgggt
caaccaatagccctggcctctcttttcctgtgcgtggtggtcaaggattatgtgcccgat
gatctttccaacttcgcagaggcgctagctaacccgattaaataccaaagtgagctagag
aagcgcgatattcaactgtctgttttgaccgacgaagccgaagcgctgggcagtgcggac
gaagatctctccaagtcgttcgttttcgtccaagtaggtggccaaaaaaaggagctgcgt
ccggttgaatcgcttgcgacttcgcccaagcataggccgagtatctcggctgccgcagca
atgagtgttgacgttaccgtggatcggaccgatggcggaaggggagaagatagcgtctct
attgtggcaccatcaatacagcatcagcactccctagaccagtccgtaagcacctccatc
cgccaggtggagtcctcgcagtttgatgtggatcttgtgttggcggagccgctggaaaag
atcttggatcacaagtccgtcaaggaaaagcgtctcgagatggaaaagaagctggagtcg
ctgcgaaagaagcatgacaaggaaaaggttaagatcgccggccagaaatccagtccgcta
gagggcaagaagccgaagtttgccataacgaataagctggtgaagcggctaagcaacaag
agtcttaattgtctctctccgcacagcgagcctggtatagagatccccgcctgccctctg
gatctgggcgatagcagcgaggagagtgcagccgcggatgccggtgaggacttagccggc
gggagcagcagcctggatggcagaactcaagagtcgcgattacgcagtgcctgccgggag
tacacttcccagtaccgtgagctgcaggagaagtaccatgaggctatttacagtgcagcc
gagaaggtgctgaagacatcgcaaactggtcaaacaaagcagttaaaagcatctctagac
aaggtcactggagaggttatgcaccagctgcaggaggcacgccgcaacgaggttaagaat
ctggccaccgtgcaccgggatcgtgatgagctgatcagaatgaaacgcgaggtggcaagc
tccgttgtggaacgtggcgtagctgaacgtgtgcggctgaagcagacctttgaccgaaga
acggatgagcttcagaagcagcacgactcagtgcgcaatgccctggcagaacaccgctcc
aaggctcgtcaaattctcgacaaggaggcagaatcgcgaagctgtgtatccagcaatggc
ttcttggtcctcttccatggacctcatcaccacggctgttcgggttccagctcgtcagcc
ctatcaggcaataatctcactctaaatctggacgcgggggctaccgctagtcattcggcc
atttcgccggccaggtcgcacaacagcatcgcagcagcggccgagatgaagacgtaa

DBGET integrated database retrieval system