KEGG   Drosophila simulans: Dsim_GD23288Help
Entry
Dsim_GD23288      CDS       T01065                                 

Definition
GD23288 gene product from transcript GD23288-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsim_GD23288
Transfer RNA biogenesis [BR:dsi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dsim_GD23288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 552 aa AA seqDB search
MKAKKKLGVGLSRQERQVLVIGEIIQELLKAHEAKKDVNLNRMKSLVASKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRSRYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLP
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLSY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGECSIVRELHVY
GSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSTKLAVISGVGTRNYYRKMGYELD
GPYMSKSIEENN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaaaaagaagttgggcgtgggattgagccgccaggaacggcaggtgctcgtc
atcggggagatcattcaggagctgctaaaggcgcacgaagccaaaaaggatgtaaacctt
aaccggatgaaatcattggtggcctccaaatatggactggacagttcgccgcgcctggtc
gatatcattgcagccgtgccgcaggacgccaaaaaaattctgcttccaaagctgagggcc
aagcccattcgcacagctagtggcatcgcagtggtggccgtcatgtgcaagccgcatcgt
tgtccgcacatcaatatgaccggcaatatatgcgtctattgtcccggcggaccggacagc
gactttgagtactcgacacagtcgtacactgggtacgagccgacctcaatgcgagccatc
cggtcgcggtacgatccctttcttcagacccgacaccgcgttgaacaactgaagcagctg
ggacacagtgtggacaaggtggagttcatagtaatgggcggtacgttcatgtgcctgccg
gaggagtaccgcgactacttcatccgcaacctgcacgacgccctatccggccacagcagc
gccaatgtagcggaggccgtacgctactcggagaagtcacgcacaaagtgcattggcatc
accatagaaacaaggccggattactgcctcaagcggcacatatcggatatgcttagctat
ggttgcacccggttggaaatcggtgtgcaatcggtttacgaagacgtagccagggatacg
aaccgtggacacacggtgcgagcggtgtgcgagagctttcagctaggcaaggatgctggc
tacaagatcgtgacgcacatgatgcctgatcttcccaatgtggacttcgaacgcgacatc
gagcagttcatcgagtactttgagaaccctgcctttcgctctgacggcctgaagatctat
cccacgctcgtcattcgcggcactggtctctacgagttatggaaaaccgggcggtataag
tcatatccgccatccatgcttgtcgacctagtggctaagattttggcccttgtaccacca
tggacgcgagtgtaccgcgtacagcgcgacattcccatgccgcttgttagttccggcgtg
gaacacggaaatctccgcgaactggcgctggcccgcatgaaggatcttggcaccacttgc
cgcgacgttagaacccgcgaagttggcattcaggaaatccacaacaaggtgcgcccttac
gaaattgagctaattcgtcgggactatgtggccaatggcggctgggaaacgttcctctca
tacgaagatcctgaacaggacattctcgtaggccttcttaggctgcgaaagtgctcaccg
gataccttccgtccggaactgaagggcgaatgctccattgtgagggagctgcacgtatat
ggctcagtcgtgccggttaatgctagggatcccaccaagtttcagcaccagggcttcggt
atgttgctgatggaggaggcggagcgaattgctcgagaggagcacggcagcacaaaactg
gcggtcatatcgggagtgggcaccaggaactactaccgcaaaatgggatacgaacttgac
ggaccctacatgtcaaagagcatagaagaaaataactaa

DBGET integrated database retrieval system