KEGG   Drosophila simulans: Dsim_GD23403Help
Entry
Dsim_GD23403      CDS       T01065                                 

Definition
GD23403 gene product from transcript GD23403-RA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 679 aa AA seqDB search
MASEQTIDGAATIPSGGGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQP
TTVCTTSASDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEE
CDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVDLTGLNYAVFGLGNK
TGGHYNKVAIYVDKRLEELGANRVFEVGVGDDDANIEDDFITWKDRFWPAVCDHFGIEGG
GEEVLIRQYRLLEQPEVQPDRIYTGEIARLHSIQNQRPPFDAKNPFLAPIKVNRELHKGG
GRSCMHIELSIDGSKMRYDAGDHVAMFPVNDKSLVEKLGQLCNADLDTVFSLINTDTDSS
KKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKY
QSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLV
EYKTPTGRINKGVATTYLKNKQPQGSEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLA
PFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQ
GKKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADA
VQYIKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagcaaacgattgatggagcagccacaattcccagcggcggcggcgacgaa
cccttcctgggcctgctggacgtagccctactggcggtgctaatcggcggcgcagccttc
tacttcctgcgcagtcgcaagaaggaggaggagccaaccaggagctattccatacaaccc
accacagtgtgcaccacgagtgcgtcggacaactcgttcatcaagaagctcaaggcatcc
ggacgcagtctggtcgtcttctatggctcacagaccggaacaggcgaggagttcgccggc
cgtctggccaaggagggcattcgttaccgtctaaagggcatggtggctgatcccgaggag
tgcgacatggaggagctgctgcagctgaaggacatcgacaactcgctggcggtcttctgc
ctggccacctacggcgaaggagatcccactgacaacgccatggagttctacgagtggatc
accagcggtgatgtcgacctaaccgggctaaattatgcggtctttggcttgggcaacaag
acgggggggcactacaacaaggtggccatctatgtggacaagcgactggaggagctgggc
gccaaccgggtcttcgaagtgggagtgggcgacgatgatgccaacatcgaggatgacttc
atcacgtggaaggatcgcttctggcccgccgtgtgcgaccactttggtattgagggcggc
ggcgaggaagtgctcatccgtcagtaccgtctgctggaacagccagaggtgcagcctgac
cgcatttacactggagagatcgcccgcctgcactcgattcagaaccagcgcccgcccttc
gacgccaagaatcccttcctggcccccatcaaggtgaaccgcgagctgcacaagggcggt
ggccgctcctgcatgcacattgagctgagcatcgatggttccaagatgcgctacgacgct
ggtgatcatgtggccatgttcccagttaacgacaagagtctggtggagaagctcggccag
ctgtgcaacgccgatctggatactgtgttctcgctgatcaacaccgatacggacagcagc
aagaagcacccattcccttgccccaccacgtaccgcaccgctctgacccactacttggaa
attacggccattccccgtacgcacatcctcaaggagctcgctgagtactgtactgacgag
aaggagaaggagttgctgcgcagcatggcctccatcagtcccgaaggaaaggagaaatac
cagagctggattcaggacgcctgtcgcaacattgtccacattctggaagacatcaaatcc
tgtcgccctcctatcgatcacgtttgcgagctgctgccccgcttgcagccccgttactac
tccatctcgtcgtctgctaagctgcaccccactgatgtccacgtgacagccgttctcgtg
gagtacaagacgccgacgggacgcatcaacaagggcgtggccaccacatatctcaagaac
aagcaaccgcagggcagtgaggaagtaaaggtgccggtattcatccgcaagtcgcagttc
cgtttgcctacgaagccagagacacctatcattatggtgggtcctggcacgggcttggcc
cccttccgcggtttcattcaggagcgacaattcctgcgcgatgagggcaagaccgtgggc
gagtcgattctctacttcggttgccgtaagcgcagtgaggactacatctacgaatccgag
ttggaggagtgggttaagaagggcactctcaacctgaaggccgccttttctcgtgaccag
ggcaagaaggtctacgtgcagcacctgctcgagcaggacgcagatcttatatggaacgtg
attggcgagaataaggggcacttctacatatgcggtgatgctaagaacatggccgtggac
gttaggaacattttagtgaaaattttgtccactaagggtaacatgagcgaggctgacgcc
gtgcagtatatcaagaagatggaggctcagaagcgctactcggccgatgtctggagctaa

DBGET integrated database retrieval system