KEGG   Drosophila simulans: Dsimw501_GD23403Help
Entry
Dsimw501_GD23403  CDS       T01065                                 

Gene name
Dsim_GD23403
Definition
(RefSeq) GD23403 gene product from transcript GD23403-RD
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dsimw501_GD23403 (Dsim_GD23403)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 679 aa AA seqDB search
MASEQTIDGAATIPSGGGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQP
TTVCTTSASDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEE
CDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVDLTGLNYAVFGLGNK
TYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEGG
GEEVLIRQYRLLEQPEVQPDRIYTGEIARLHSIQNQRPPFDAKNPFLAPIKVNRELHKGG
GRSCMHIELSIDGSKMRYDAGDHVAMFPVNDKSLVEKLGQLCNADLDTVFSLINTDTDSS
KKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKY
QSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLV
EYKTPTGRINKGVATTYLKNKQPQGSEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLA
PFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQ
GKKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADA
VQYIKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagcaaacgattgatggagcagccacaattcccagcggcggcggcgacgaa
cccttcctgggcctgctggacgtagccctactggcggtgctaatcggcggcgcagccttc
tacttcctgcgcagtcgcaagaaggaggaggagccaaccaggagctattccatacaaccc
accacagtgtgcaccaccagtgcgtcggacaactcgttcatcaagaagctcaaggcatcc
ggacgaagtctggtcgtcttctatggctcacagaccggaacaggcgaggagttcgccggc
cgtctggccaaggagggcattcgttaccgtctgaagggcatggttgccgatcccgaggag
tgtgacatggaggagctgctccagctgaaggacatcgacaactcgctggcggtcttctgc
ctggccacctacggcgaaggagatcccactgacaacgccatggagttctacgagtggatc
accagcggcgatgtcgacctgaccgggctaaattatgcggtctttggcttgggcaacaag
acctatgagcactacaacaaggtggccatctatgtggacaagcgactggaggagctgggc
gccaaccgggtcttcgaactgggactgggcgacgatgatgccaacatcgaggatgacttc
atcacgtggaaggatcgcttctggcccgccgtgtgcgaccactttggtattgagggcggc
ggcgaggaagtgctcatccgtcagtaccgtctgctggaacagccagaggtgcagcctgac
cgcatttacactggagagatcgcccgcctgcactcgattcagaaccagcgcccgcccttc
gacgccaagaatcccttcctggcccccatcaaggtgaaccgcgagctgcacaagggcggt
ggccgctcctgcatgcacattgagctgagcatcgatggttccaagatgcgctacgacgct
ggtgatcatgtggccatgttcccagttaacgacaagagtctggtggagaagctcggccag
ctgtgcaacgccgatctggatactgtgttctcgctgatcaacaccgatacggacagcagc
aagaagcacccattcccttgccccaccacgtaccgcaccgctctgacccactacttggaa
attacggccattccccgtacgcacatcctcaaggagctcgctgagtactgtactgacgag
aaggagaaggagttgctgcgcagcatggcctccatcagtcccgaaggaaaggagaaatac
cagagctggattcaggacgcctgtcgcaacattgtccacattctggaagacatcaaatcc
tgtcgccctcctatcgatcacgtttgcgagctgctgccccgcttgcagccccgttactac
tccatctcgtcgtctgctaagctgcaccccactgatgtccacgtgacagccgttctcgtg
gagtacaagacgccgacgggacgcatcaacaagggcgtggccaccacatatctcaagaac
aagcaaccgcagggcagtgaggaagtaaaggtgccggtattcatccgcaagtcgcagttc
cgtttgcctacgaagccagagacacctatcattatggtgggtcctggcacgggcttggcc
cccttccgcggtttcattcaggagcgacaattcctgcgcgatgagggcaagaccgtgggc
gagtcgattctctacttcggttgccgtaagcgcagtgaggactacatctacgaatccgag
ttggaggagtgggttaagaagggcactctcaacctgaaggccgccttttctcgtgaccag
ggcaagaaggtctacgtgcagcacctgctcgagcaggacgcagatcttatatggaacgtg
attggcgagaataaggggcacttctacatatgcggtgatgctaagaacatggccgtggac
gttaggaacattttagtgaaaattttgtccactaagggtaacatgagcgaggctgacgcc
gtgcagtatatcaagaagatggaggctcagaagcgctactcggccgatgtctggagctaa

DBGET integrated database retrieval system