KEGG   Drosophila simulans: Dsimw501_GD23471Help
Entry
Dsimw501_GD23471  CDS       T01065                                 

Gene name
Dsim_GD23471
Definition
(RefSeq) GD23471 gene product from transcript GD23471-RB (EC:2.3.1.-)
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsimw501_GD23471 (Dsim_GD23471)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dsimw501_GD23471 (Dsim_GD23471)
   HAT complexes
    HBO1 complex
     Dsimw501_GD23471 (Dsim_GD23471)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 829 aa AA seqDB search
MALESGSSSSESGSSSTSGSTSSETGSSSDTDSSSATPEEKPSTNSSAKSQTQTQQQTNS
GNAQRRKPVPAAAEDKPKPSVAPSSKKVNNPPKSKLSSDDDEDEDSAPPAKKNSRAMGSS
TVTAAAAASAARRKPPASVNKPSNPANKPSNPTQRSANNNTNRSLENGEGKRPSLSSSSN
STDDSMKIVKNGRKVPLKMASTVRPKQIRGKLPPAKKNGGGPVISSDGSSGSESGSNSGD
ESSSGSESEGSDSSNSYSSQPVKGGAKGKRSGPPKLQNSDSEEERKDKANPMRKLTRSLS
MRRTKQQPKQETDSESDGDLEDDKIMISKSPAKKPAPSNLNASKSKVKREPIGISSGVLS
SIKSRPVSPITQTEKKCPIEGCDSSGHLSGNLDKHFLPEACPIYHNMSASECKERANERK
LRNEQRLKMPVNIVTAPGNQNTNLKTLSPEQREFLAKIRESRANFKPANNNFLDSKVKLE
KDVTDEDREPNLAGLVPDYDLQLFREAQAQASERIEDELKDLPVGKGIKYISMGKYKMKV
WYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAEKCVWRHPPGDEIYRKGKLQVWQV
DGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIPFLQE
KNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYRSYWKD
VLLDYLCNRSGNTIAIKDVSQETAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVLDEYE
ERVKRRGTFPQDRRLLLKMAALHQYPAELISITTWLEACQGMLCGRRRR
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggccttggagtccggcagcagcagctcggagtcgggcagctcctccacaagcggatct
accagttcggaaacgggcagcagctcggacacggattccagcagtgcgacgccggaggag
aagccatccacgaattcatccgccaaatcccagacgcaaacacaacaacaaacgaattcc
ggaaatgcacagagaagaaagcctgttcctgcggcggcggaggataaacccaagccgagc
gtagcgccatccagcaaaaaagtaaacaatcctcccaaaagtaaactctccagcgatgac
gacgaggatgaggactcggcgccgccggccaaaaagaactcacgtgcaatgggcagttcc
actgtaacagcggcagctgccgcctcagcagccaggaggaaaccacccgcgtccgtcaac
aagcccagcaatccagctaacaaacccagcaatcctacccagcgatcggccaacaacaac
actaatcgatcactggagaacggcgagggcaagcgaccctcgctctcctcctcgtccaac
agcacggatgactctatgaagatcgtcaaaaacggccgcaaggttcccctcaaaatggcc
agcacggtgaggcccaaacaaatccgaggaaaattgccgccggcaaagaaaaacggcggg
ggaccggtgatcagcagtgacggcagttcgggctccgagagtggctccaactcgggcgac
gaatcaagctcaggaagcgagtctgagggaagtgattccagcaactcctacagctcgcag
ccagtaaaaggaggagctaaaggtaaaagaagcggtccaccgaaactgcaaaactccgac
agcgaagaagagcgaaaagacaaggccaatcccatgaggaaactgacgagatcactcagc
atgcgaaggacaaaacagcagcccaaacaggaaaccgattctgaatccgatggagaccta
gaagatgacaaaattatgatctccaaaagtcccgccaaaaagccagcgccctcgaatttg
aacgccagcaaaagcaaggtgaaaagggaaccaatcggaatcagcagtggagtcctgagc
tccattaaatcccgacccgtgtcacccattacccagactgagaagaagtgtcccatcgag
ggttgcgattcatccggccacctgagtggcaatttggataagcactttttgccggaggcc
tgtcctatctatcacaacatgtccgcctcggagtgcaaagagcgggccaatgagaggaag
ctgaggaatgaacagcgactaaagatgccggttaacattgtgacggcgccgggtaaccaa
aacaccaatctcaagacgctctcgccggagcagcgcgagtttctggccaagattcgcgag
tcaagggctaacttcaagccggcgaataacaattttttagactcgaaggttaagctggaa
aaagacgtaacggacgaggaccgggaaccaaatctggcaggcctggtgcctgactatgat
ttgcaattgttccgggaagcgcaagctcaagcctccgaaaggatcgaagacgaactcaag
gacctgcccgtgggaaagggaataaaatatatcagcatgggcaagtacaagatgaaggtc
tggtatcaatccccctatccggacgatgctgcccgcctgcccaaaatgtatatctgcgag
ttctgcctgcgataccaaaaatcagagacgggcatcaagcggcatgccgagaaatgcgtc
tggcggcatccgccgggcgatgagatataccgcaagggtaaactacaggtgtggcaggtg
gatgggaagcgttataagcaatactgtcagcatctgtgcctgctggcaaaattctttctg
gatcacaaaaccctctactacgatgtggagcccttccttttctacatcatgacgctggcc
gatgtggacggatgccatattgttggttattttagcaagcatattcctttcctgcaggag
aagaactcgttttacaatgtgtcctgtattttaacattgccgccatatcagcgaaagggt
tacggcagattactaatcgatttcagctatctgctgacccgcgtggagggaaaaatcggc
tcgccggagaaacctctatccgatctgggcctgatctcgtaccgctcgtactggaaggat
gtgctcctggactacctgtgcaatcgatcgggaaacacgatcgccatcaaggatgtttcg
caggaaactgcgatttactcttacgacattgtgagcacccttcaagctctcggaatgatg
aagtactggaagggcaagcacatagtgctcaagaagcaagacgtactggatgagtacgag
gagagggtgaagcgaagaggaaccttcccccaagatcgacgactcctgcttaagatggca
gcccttcatcaatatccagccgagctcatctccataaccacgtggttggaagcatgccag
ggcatgctttgcggacgccgacgacgatga

DBGET integrated database retrieval system