KEGG   Drosophila simulans: Dsim_GD23472Help
Entry
Dsim_GD23472      CDS       T01065                                 

Definition
GD23472 gene product from transcript GD23472-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsim_GD23472
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsim_GD23472
   00020 Citrate cycle (TCA cycle)
    Dsim_GD23472
   00620 Pyruvate metabolism
    Dsim_GD23472
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dsim_GD23472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 496 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSTGNVVVRALSSQLINSRNLQSIRSKLNTS
QSPVTWSYNFARAYANLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAAAAPAAP
AAAPAPAPAPAAAAAPPPPPAAAPAAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQL
RLQGQKPAAKPAAAAPAKAPKAAGTRYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQ
VDKLLKFRAKVNKKYEKQGARVSVNDFIIKAVAIASLRVPEANSAWMDTVIRKYDDVDVS
VAVSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQGGTISVSNLGMFG
VNQFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLSADHRVVDGAVAARW
LQHFRDYMEDPSNMVL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaacttggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcgacgggaaatgtggtagtgcgcgccctc
agcagccagctgatcaactcccggaatctccagagcatcaggtcgaaactcaacactagc
cagtcgccggtcacatggagctacaacttcgcccgtgcctatgcaaaccttccggaacac
atcagggtgccactgcccgcgctttcacccactatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgacaagctcaacgaaggtgacctgctgtgtgagattgagacggac
aaggccaccatgggcttcgagacgcccgaggagggctttctggctaagattctcatccag
ggcggcaccaaggacgttcccgtgggccagctgctgtgcattatcgtaccggaccaaggc
agcgtagctgccttcgcgaacttcaaggacgacggtgccgcagcagcaccagctgctccg
gcagcagctccagctccagctccagcacccgcagcagcagcagcaccgccaccaccaccc
gccgcagctccagctgccgctgcgcccccaccagctcccgctgctgctccagctgcagca
ggtacgggccgtgtgtatgccagtcccatggccaagcgactagccgaggcacaacagctg
cgtctacaaggccagaagccagcagccaagccagctgctgcggcacctgccaaggcaccc
aaggcagctggaacgcgctacgaggacatcccggtgaccaacatgcgcgcagtgattgcc
aaacgcctgctggagtcaaagacccaactgcctcactactacgtcactgtgcaatgccaa
gtggataagctcctgaagttccgcgcgaaggtgaacaagaagtacgagaagcagggtgcc
cgcgtctctgtgaacgacttcattatcaaggccgtggccatcgccagtcttagggttccc
gaagcgaactccgcctggatggacactgtaatccgcaagtacgacgacgtcgacgtttct
gttgctgtctccacagataagggtctgattaccccgattgtcttcaatgccgaccgcaag
ggagtcctggagatctccaaggatgtcaaggctctggcagccaaggcgcgcgacaacaaa
ctgcagccccacgaattccagggtggcaccatttcggtttctaatctgggcatgttcggt
gtgaaccagtttgccgctgttatcaaccctcctcaatcgtgcatccttgccattggtacc
acaacgaagcagttggttgctgatcccgacagtttgaagggcttcaaggaggtcaacatg
ctgacggtcaccctgagtgctgatcatcgtgttgtggatggtgctgttgctgccaggtgg
ctgcagcacttccgcgactacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system