KEGG   Drosophila simulans: Dsim_GD23486Help
Entry
Dsim_GD23486      CDS       T01065                                 

Definition
GD23486 gene product from transcript GD23486-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dsi  Drosophila simulans
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dsi00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:dsi00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 351 aa AA seqDB search
MFATPLRQPAAANQTPKDSAGMDDHGKPYQYEITDHGYGKDAVKVLHVSRKGPVHTIQEF
EVGTHLKLYSKKDYYHGNNSDIVATDSQKNTVYLLAKKHGIESPEKFALLLARHFINKYS
HVEEAHVHVEAYPWQRVCQEETRTNVNGKCENGVQGNCDFSSIDNRSLHNHAFIFTPTAL
HYCDVVIRRTDPKQTVITGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCSW
EYSDTENLDFLRAWQTVKNIIIRNFAGDPQVGVSSPSVQHTLYLSERQVLDVLPQVSVIS
MTMPNKHYFNFDTKPFQKIAPGDNNEVFIPVDKPHGTIYAQLARKNINSHL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacgcccctcagacagccagctgcggctaaccagaccccaaaggattccgcc
ggcatggatgaccatggtaagccgtatcagtacgagattaccgatcacggatacggcaag
gatgcggtcaaggtgctgcatgtcagccgcaagggacccgtgcacaccatccaggaattc
gaggtgggcacccacctgaaactgtacagcaaaaaggattactaccacggcaacaactcg
gacatcgtggccaccgattcgcagaagaacaccgtctatctgctggccaaaaagcatggc
atcgagagtcccgagaagtttgccctgctcctggccaggcacttcattaacaagtactcg
cacgtggaggaggcgcacgtccatgtggaggcgtatccctggcagcgagtttgccaggag
gagaccaggaccaacgttaatggaaagtgcgagaacggagtccaaggcaactgcgacttc
agctccattgacaacagatcactgcacaatcacgcttttatattcacgcccaccgctctt
cactactgcgatgtggttataaggagaacagatcccaaacaaacggtcatcacgggcatc
aagggtctccgggtgctaaagacgacccaatcctcgttcgtgaacttcgtgaacgatgag
ttcagatctctgccagatcagtatgatcgcatctttagcaccgtggtggattgctcctgg
gagtactccgacaccgagaacttggacttcctgagggcctggcagacggtcaaaaacata
atcattcgtaactttgctggtgatccgcaggtgggcgtgtcctcgccatccgtccagcac
accctgtatctgagtgaaagacaagtgctggatgtcctgccgcaggtgtcggtcatttcg
atgaccatgccgaacaagcactacttcaacttcgatacgaagcccttccagaagattgca
cccggcgacaacaacgaagttttcatcccagtggacaagccacatggcaccatctatgcc
cagttggcacggaagaacatcaatagtcacctgtag

DBGET integrated database retrieval system