KEGG   Drosophila simulans: Dsim_GD23497Help
Entry
Dsim_GD23497      CDS       T01065                                 

Definition
GD23497 gene product from transcript GD23497-RA
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dsim_GD23497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 774 aa AA seqDB search
MGQKLSFSKKCSDWKWCTSKDNEEPTLRIRNANYFTGAPQGDKTDGASSAVLGVLKVDLC
LEDNHEEHHTSHFYAAAAKEALVVRRGEPFRLKIHFNRDYSPSKDAISFIFTVADDTKPS
PGHGTLNALVPHDGIDYLGDTLEWGAGIESHEGQTLTVLIKPPSTCPVTEWKLDIDTKLL
GDGSRSYPLPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVWKI
GQFERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFSGG
VAPTKWTGSVEILQQFHKTQKSVKFAQCWNFSGVLTTIARSLGIPSRIITCYSSAHDTQA
SLTVDVFIDSNNKKLDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFEGRQVVDATPQEA
SDNMYRVGPASVAAVKNGDILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLAIG
HLISTKAVLKWEREDITDTYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNEIEFDM
ELKDDIKIGQSFSVVLKVSNKSESRTHMATGQISCDAVLYTGVGAVEVKTLGFELELEPK
SSDYVRMEVIFEEYYDKLSSQASFQISAAAKVKDTDYDYYAQDDFRVRKPDIKFQLGEAA
IVAQKELDVILRLENPLPIPLHKGVFTVEGPGIEQPLKFKIAEIPVGGTAAATFKYTPPY
AGRGTMLAKFTSRELDDVDGYRHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVIA
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaactatcgttttcgaaaaagtgcagcgattggaagtggtgtacatctaag
gacaacgaggagccaacgctgcgtatacgcaatgccaactattttacgggcgctccacaa
ggcgacaaaacagatggcgccagctcagcagtattgggcgtgttgaaggtcgatctgtgc
ctggaggacaaccacgaggagcaccacacgagtcacttctacgcggcagccgccaaggaa
gcgttggtcgtgcggcgaggagaacccttccggctcaagatccacttcaatcgggactac
agtcccagcaaagatgccattagcttcattttcaccgtggcggatgacaccaaaccaagt
cccggtcatggaacactcaatgccctggtgccgcacgatggcatcgattatctgggcgac
actttggaatggggagccggcatcgaatcgcatgagggtcaaacgctcaccgtgctgatc
aagcctccatccacctgtcccgtaacggaatggaaactggacatcgacacgaagctgctg
ggagatggatcgcgaagctatcccctgccgctgcccatatatgtactcttcaatccctgg
tgtccggatgatcaggtgtatctggaggatcgcgaccagcgcaaggagtacgtgatgcac
gataccacactcatctggaggggatcgtacaacagattgcgtccatcggtttggaaaatc
ggtcaatttgaacggcatgtgctcgagtgcagcctgaaggtactgggtacggtgggcagg
attccgccggcctacagaggcgatcccgtgagagttgctcgcgccctgtccgcactggtg
aactcggtggatgatgacggtgttctgctgggcaactggtcggaggacttctccggcggc
gtggcgcccaccaagtggacaggctccgtggagattcttcagcaattccacaagactcag
aagtcggtgaagtttgcacagtgctggaatttcagcggtgtcctgaccaccattgccagg
agtctgggaataccgtctaggatcatcacttgctactcctccgcccacgatacacaggcc
tcactcaccgtggacgtgttcatcgactcgaacaacaagaagttggatgcggagaccacg
gattcgatctggaactaccacgtgtggaacgagctctggatgcagcgacctgacctgggc
gtgggtgagcacgggaccttcgaaggtaggcaggtggtggacgccacaccgcaggaggcc
tccgataatatgtatcgagtgggtcccgcttccgttgcggcggtgaaaaatggtgacatc
ctgcgacccttcgatggtggcttcgtcttcgcggaggtgaatgcggataagctttattgg
cgctacaatggacccagccagccgcttaagctgctcaggaaggatacgctggccatagga
cacctcatcagcacgaaagcggtactcaaatgggaaagggaggacatcaccgatacgtac
aagcatgccgagcgctccgaggaggagaggagcaccatgctcaaggccctcaagcaatcc
cgacatgcgttcagtagatactatctgaatgacaatttcaatgagattgagtttgatatg
gagctgaaggacgacatcaagattgggcagagcttcagtgtggtcctaaaggtgagcaac
aagagcgagagtcgcacccacatggccacgggtcagataagttgcgatgccgtgctctac
acgggcgtgggtgccgtggaggtcaagaccctgggcttcgaactggaattggagcccaag
agcagcgactacgttcgcatggaggtgatcttcgaggagtactacgacaagttgtcctcg
caggcgtccttccagatctccgcggccgccaaagtcaaggacaccgactacgattactat
gcccaggatgatttccgggtgcgcaagccggacattaagttccagctgggtgaggctgcc
attgtggcccagaaggagctggacgttattctgcgactggagaacccgctgcccattccg
ctgcacaagggtgtgttcacagtggagggtcctggcatcgagcagcctctcaagttcaag
atcgctgaaattccagtgggtggcactgcggctgccaccttcaagtacactccgccctat
gcggggcgtggcaccatgctggcgaagttcacgtccagggaactggacgatgtggatggc
tataggcactacgagattgagccacgaccggaggatctgctgcagccgaatggaagccac
cgcagcagcaacatcatacgcaggcgcaccgatgtaatagcctaa

DBGET integrated database retrieval system