KEGG   Drosophila simulans: Dsim_GD23520Help
Entry
Dsim_GD23520      CDS       T01065                                 

Definition
GD23520 gene product from transcript GD23520-RA
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dsim_GD23520
    1.3.1.94  polyprenol reductase
     Dsim_GD23520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 326 aa AA seqDB search
MAAPENGILEVLENLLDRYKINLLQMMFGTFIATIVFFGGLMTFVEKYLPNSIRQSFRYG
KHSFKGETDPLVAWLEVPKSWFKHFYVFALFWSWLAFYVLVSTVREQKEAPEYVLRFLDI
MGGGRSHRKVEIDSTTACVGALMLTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYVHYF
GAIIALLSNTSGFVRGSKPMEFSLDKLTGQQILYLGVFFLAWQQQYASNMILVNLRKDPR
TGNVKTEKHLLPKGGLFNLLSSPHMFLEVVMYFCIADLYMPVKIWRLIFLWVASNQTINA
LLTHKWYRETFKEYPKNRRAIIPFLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacccgaaaatgggatccttgaggtcctcgaaaacctactcgaccggtacaaa
atcaacctgctgcaaatgatgttcggcaccttcatcgccacgatcgtgttctttggcgga
ctgatgactttcgtggagaagtacctgcccaatagcatacgccagtcctttcggtatggc
aagcacagtttcaaaggtgaaacggatcccttggtggcctggctggaagttccgaagtcc
tggttcaagcacttctacgtctttgctctattctggagctggcttgcattttatgtgctc
gtttcaaccgttcgggagcaaaaggaggcgccggaatatgtactccgattcctggacatc
atgggcggcggacggagtcaccggaaagtggagatcgactcgacgactgcctgtgtgggc
gcactcatgctcacgttgcagtgcacccggcgtttttacgagaccaactttgtgcagatc
ttctccaagaagagcaaaatcaatctgtcgcactatgccgtgggctatgtgcactacttt
ggagccattatagctttactatccaatacctccggctttgtgcgcggctcgaagcccatg
gagttcagcctcgacaagctgacaggccagcaaatactctacctcggcgtcttctttctc
gcctggcagcagcagtacgccagtaacatgatattggtcaacctgaggaaggatccgcgg
acgggaaatgtcaaaacggaaaagcaccttctgcccaagggtgggcttttcaatctgctt
tcgtcgccgcacatgttcctcgaggtggtcatgtacttctgcatcgccgatctctacatg
ccagttaagatttggcgactgatcttcctctgggtggccagcaatcaaacgatcaatgct
ctgctaacccacaagtggtaccgggaaacattcaaagaatatccaaagaaccgacgtgct
atcattccgttcctgctctga

DBGET integrated database retrieval system