KEGG   Drosophila simulans: Dsimw501_GD23660Help
Entry
Dsimw501_GD23660  CDS       T01065                                 

Gene name
Dsim_GD23660
Definition
(RefSeq) GD23660 gene product from transcript GD23660-RB
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2L
AA seq 1013 aa AA seqDB search
MACFPRLFHHRSKNKFTPAEDENTDTILNTHDSPVQIGQYIRREEKPLYSPIVTPSASEA
KLQRLRQQPPGSPPAPARWTLQSVAENGSANNGVQERKFRSNKDKLQAQDACPSGGSAIN
VTRSSSKLKPVKERRPTALPSEVPSIEIEDVRDAGDGKDSLGERVALQSGANAHVDVVDG
GGKSKLKVNVNGIIDEGVAHDVDDDTPSSTSIATTPVTEGPVKFFIGHTQELSAQQTDDT
LSCQSSDANNNNSSSSSSSAAKLTNGVLPQEQPEREQDRKQDSRGNQQALQAPPRAKSSS
NVSLNYLAKSQTDSQRRRRVSTMPDINIPPAPPLPPELLVPGTPLHLRKKRSVERPQQQE
QQQQEIQQDATNSQDQIAGAEEGGESHKSSDSSTPKTHRVEGGLIYVRPNFPIQGDIEIE
SIAKDEGTRNLIRTAIERNDFLNNLMDKERKEMVINAMAPASYRKHSLIIREHEEGSEIY
VSAEGQYDVIRGGQLVASFGPATVFGELAILYNAPRQASVEAATDARVWKIARETFRAIM
QISGSREREENLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVREGELGNEFYII
RCGTVTIKKRDDQQQEQIVANRKRGDYFGEQALLNADVRQASVYADAPGTEVLMLDREAF
ISYLGTIKQLREKPSSQRNDTSGRSSNKSLEFDNEYSQVAISELKKIATLGCGAFGRVDL
VAYNQQALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLM
EACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPENLMLGTDGYC
KLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLVGKTPF
RGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHSW
FESLDWQRLKLKQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEELSGWDKDF
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccacgacttttccatcatcgcagcaaaaacaaattcacgcccgccgaa
gatgagaacaccgatacgatactcaacacacatgacagtcccgtgcaaattggtcagtac
attcgtcgcgaggagaagccactgtactcgcccatcgtcactccgagtgccagtgaggcc
aaacttcagcgcctcagacagcagccgcccggctcaccgcctgcacccgccaggtggacc
ctgcagtcggttgccgaaaatggcagcgcaaacaatggcgtccaggagcggaagttccgc
tccaacaaggacaaactgcaggctcaggatgcatgcccatccggcggcagtgcaattaat
gtcacacgctcaagttcgaaattaaaaccagtcaaagagcgtcggcccaccgccttgccc
agcgaggtgcccagcatcgagatcgaggatgttcgggatgctggagatggcaaggattca
ctgggggagcgggtggcgctccagtcgggtgctaatgcacatgtcgatgtcgtcgatggc
ggcggcaagtcaaaactcaaagtgaatgtgaatggcataattgatgagggcgtcgcccac
gacgtcgacgatgacacaccctcgagcacctccatagccacaacacctgtgaccgagggt
cctgtaaagtttttcattggtcacacgcaggaactaagcgcccagcaaacggatgacacc
ttgtcctgccagagtagcgatgccaacaacaacaacagcagcagcagcagcagcagtgcc
gccaaactgacaaatggcgtcctgccacaggagcaaccggaacgggaacaggacaggaaa
caggattccagggggaaccagcaagcactccaggctccgccccgcgccaagagctccagc
aacgtgtcactcaattatctggccaagagccagacggacagccagcgtcgccgacgtgtg
tccacgatgcccgatattaacataccgccagcaccgccattgcctccggaactcctcgtc
cccggaacgccgctccatctgcgcaagaaacggagcgtggagcgaccgcagcagcaggag
cagcagcagcaggagatccagcaggatgctacgaatagtcaagatcaaattgcaggagca
gaagagggcggcgagagtcacaagtccagcgattcctcgacaccaaaaacccatcgcgtg
gaaggtggcctcatctatgtccgtcccaattttcccattcagggcgacattgaaatcgaa
tctattgcaaaggacgaaggcacacgcaatctcatacgaacggccattgagcgcaatgat
ttcctcaataatctaatggacaaggagcgcaaggagatggttatcaatgcaatggccccg
gccagctacaggaagcacagcctcatcatccgggagcacgaggagggttccgagatatat
gtctccgccgagggccagtacgatgtcatccgtggtggccaactggtggccagctttgga
ccggccaccgtgttcggtgagctggccattctctacaatgctccacgtcaggcgtccgta
gaggctgccaccgatgcacgcgtttggaaaatcgcacgcgaaaccttccgggccatcatg
caaatctcggggtccagggagcgtgaggagaacctacagttcctgcgctccgctccattc
ctgcaggagttcgaccagagtttgttgctcaaagtcgtggatcttttgcagcggaaattc
tacgagaccgacagctgtattgtccgcgaaggtgagctgggcaacgagttctacatcatc
cggtgcggaactgtgaccataaagaagcgggacgaccagcagcaggagcagattgtggcg
aatcgaaagcgaggtgactacttcggggagcaggcactgctcaatgcggatgtgcgacag
gccagtgtctatgcggatgcaccgggcaccgaggtcctcatgctggacagagaagccttc
attagctatttgggaaccataaagcagctgcgcgagaagcccagtagtcagcgcaacgat
acgagtggtcgatccagcaacaaatccctggagtttgacaacgagtactcccaggtggcc
atctcggagctgaagaagatagccacgctgggctgcggcgcctttggacgtgtggatctg
gtggcctacaaccaacaggcgttggccctgaagatcatcaagaaaatcgaggtggtcaag
caagatcaaatagagcacgtttacaacgagaagaacgttatgatcaagtgccgccaatcg
cccttcatagtacaactgtatcgcacgtaccgcaatgacaaatacgtttacttcctaatg
gaggcctgcatgggcggtgatgtatggacggtgatgtcaaagcgccagtacttcgatgag
aagaccgccaaatttatagcgggctgtgtcgtcgaggcattcgactatttgcactcccac
cacttcatctacagggacttgaagccagagaatctgatgctgggcaccgatggctattgc
aaactggtcgattttggatttgccaaatttgtgcgacaaaatgagaagaccaacacattt
gctggtacaccggagtacgtggcacccgagattatcctggatcgagggcacgatcgtgcc
gtcgactattgggcactgggaattctggtatatgaacttctggttggcaaaacgcccttc
aggggcgttaaccagatcaagatctatcagcaaatcctcagcggcatcgatgtcatccac
atgccatcgcgcatacccaaatccgcacagcacctggtgcggcatctctgcaagcaactt
ccggcggaaagactgggatatcagcgcaagggaatcgcggatatcaagcggcacagttgg
ttcgaaagtctcgactggcagagactgaaactaaagcaattgccatcgcccatcaaaaga
cctttgaagagttggaccgacttgcaatattttggtccttcgggcgttgagaacgactat
gagccaccggaggaactgagcggatgggataaagacttttaa

DBGET integrated database retrieval system