KEGG   Drosophila simulans: Dsim_GD23660Help
Entry
Dsim_GD23660      CDS       T01065                                 

Definition
GD23660 gene product from transcript GD23660-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 963 aa AA seqDB search
MACFPRLFHHRSKNKFTPAEDENTDTILNTHDSPVQIGQYIRREEKPLYSPIVTPSASEA
KLQRLRQQPPGSPPAPARWTLQSVAENGSANNGVQERKFRSNKDKLQAQDACPSGGSAIN
VTRSSSKLKPVKERRPTALPSEVPSIEIEDVRDAGDGKDSLGERVALQSGANAHVDVVDG
GGKSKLKVNVNGIIDEGVAHDVDDDTPSSTSIATTPVTEGPVKFFIGHTKQDSRGNQQAL
QAPPRAKSSSNVSLNYLAKSQTDSQRRRRVSTMPDINIPPAPPLPPELLVPGTPLHLRKK
RSVERPQQQEQQQQEIQQDATNSQDQIAGAEEGGESHKSSDSSTPKTHRVEGGLIYVRPN
FPIQGDIEIESIAKDEGTRNLIRTAIERNDFLNNLMDKERKEMVINAMAPASYRKHSLII
REHEEGSEIYVSAEGQYDVIRGGQLVASFGPATVFGELAILYNAPRQASVEAATDARVWK
IARETFRAIMQISGSREREENLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVRE
GELGNEFYIIRCGTVTIKKRDDQQQEQIVANRKRGDYFGEQALLNADVRQASVYADAPGT
EVLMLDREAFISYLGTIKQLREKPSSQRNDTSGRSSNKSLEFDNEYSQVAISELKKIATL
GCGAFGRVDLVAYNQQALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTY
RNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPE
NLMLGTDGYCKLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILV
YELLVGKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRK
GIADIKRHSWFESLDWQRLKLKQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEELSGWD
KDF
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccacgacttttccatcatcgcagcaaaaacaaattcacgcccgccgaa
gatgagaacaccgatacgatactcaacacacatgacagtcccgtgcaaattggtcagtac
attcgtcgcgaggagaagccactgtactcgcccatcgtcactccgagtgccagtgaggcc
aaacttcagcgcctcagacagcagccgcccggctcaccgcctgcacccgccaggtggacc
ctgcagtcggttgccgaaaatggcagcgcaaacaatggcgtccaggagcggaagttccgc
tccaacaaggacaaactgcaggctcaggatgcatgcccatccggcggcagtgcaattaat
gtcacacgctcaagttcgaaattaaaaccagtcaaagagcgtcggcccaccgccttgccc
agcgaggtgcccagcatcgagatcgaggatgttcgggatgctggagatggcaaggattca
ctgggggagcgggtggcgctccagtcgggtgctaatgcacatgtcgatgtcgtcgatggc
ggcggcaagtcaaaactcaaagtgaatgtgaatggcataattgatgagggcgtcgcccac
gacgtcgacgatgacacaccctcgagcacctccatagccacaacacctgtgaccgagggt
cctgtaaagtttttcattggtcacacgaaacaggattccagggggaaccagcaagcactc
caggctccgccccgcgccaagagctccagcaacgtgtcactcaattatctggccaagagc
cagacggacagccagcgtcgccgacgtgtgtccacgatgcccgatattaacataccgcca
gcaccgccattgcctccggaactcctcgtccccggaacgccgctccatctgcgcaagaaa
cggagcgtggagcgaccgcagcagcaggagcagcagcagcaggagatccagcaggatgct
acgaatagtcaagatcaaattgcaggagcagaagagggcggcgagagtcacaagtccagc
gattcctcgacaccaaaaacccatcgcgtggaaggtggcctcatctatgtccgtcccaat
tttcccattcagggcgacattgaaatcgaatctattgcaaaggacgaaggcacacgcaat
ctcatacgaacggccattgagcgcaatgatttcctcaataatctaatggacaaggagcgc
aaggagatggttatcaatgcaatggcaccggccagctacaggaagcacagcctcatcatc
cgggagcacgaggagggttccgagatatatgtctccgccgagggccagtacgatgtcatc
cgtggtggccaactggtggccagctttggaccggccaccgtgttcggtgagctggccatt
ctctacaatgctccacgccaggcgtccgtagaggctgccaccgatgcacgcgtttggaaa
atcgcacgcgaaaccttccgggccatcatgcaaatctcggggtccagggagcgtgaggag
aacctacagttcctgcgctccgctccattcctgcaggagttcgaccagagtttgttgctc
aaagtcgtggatcttttgcagcggaaattctacgagaccgacagctgtattgtccgcgaa
ggtgagctgggcaacgagttctacatcatccggtgcggaactgtgaccataaagaagcgg
gacgaccagcagcaggagcagattgtggcgaatcgaaagcgaggtgactacttcggggag
caggcactgctcaatgcggatgtgcgacaggccagtgtctatgcggatgcaccgggcacc
gaggtcctcatgctggacagagaagccttcattagctatttgggaaccataaagcagctg
cgcgagaagcccagtagtcagcgcaacgatacgagtggtcgatccagcaacaaatccctg
gagtttgacaacgagtactcccaggtggccatctcggagctgaagaagatagccacgctg
ggctgcggcgcctttggacgtgtggatctggtggcctacaaccaacaggcgttggccctg
aagatcatcaagaaaatcgaggtggtcaagcaagatcaaatagagcacgtttacaacgag
aagaacgttatgatcaagtgccgccaatcgcccttcatagtacaactgtatcgcacgtac
cgcaatgacaaatacgtttacttcctaatggaggcctgcatgggcggtgatgtatggacg
gtgatgtcaaagcgccagtacttcgatgagaagaccgccaaatttatagcgggctgtgtc
gtcgaggcattcgactatttgcactcccaccacttcatctacagggacttgaagccagag
aatctgatgctgggcaccgatggctattgcaaactggtcgattttggatttgccaaattt
gtgcgacaaaatgagaagaccaacacatttgctggtacaccggagtacgtggcacccgag
attatcctggatcgagggcacgatcgtgccgtcgactattgggcactgggaattctggta
tatgaacttctggttggcaaaacgcccttcaggggcgttaaccagatcaagatctatcag
caaatcctcagcggcatcgatgtcatccacatgccatcgcgcatacccaaatccgcacag
cacctggtgcggcatctctgcaagcaacttccggcggaaagactgggatatcagcgcaag
ggaatcgcggatatcaagcggcacagttggttcgaaagtctcgactggcagagactgaaa
ctaaagcaattgccatcgcccatcaaaagacctttgaagagttggaccgacttgcaatat
tttggtccttcgggcgttgagaacgactatgagccaccggaggaactgagcggatgggat
aaagacttttaa

DBGET integrated database retrieval system