KEGG   Drosophila simulans: Dsimw501_GD23774Help
Entry
Dsimw501_GD23774  CDS       T01065                                 

Gene name
Dsim_GD23774
Definition
(RefSeq) GD23774 gene product from transcript GD23774-RA
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dsi  Drosophila simulans
Pathway
dsi00062  Fatty acid elongation
dsi01100  Metabolic pathways
dsi01212  Fatty acid metabolism
dsi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Dsimw501_GD23774 (Dsim_GD23774)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsimw501_GD23774 (Dsim_GD23774)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dsimw501_GD23774 (Dsim_GD23774)
Lipid biosynthesis proteins [BR:dsi01004]
 Fatty acid synthase
  Component type
   Dsimw501_GD23774 (Dsim_GD23774)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2 Abhydrolase_1 PGAP1 Abhydrolase_6 DUF2974 FSH1 Hydrolase_4 Peptidase_S9 Abhydrolase_2 PE-PPE Cutinase
Motif
Other DBs
NCBI-GeneID: 6731969
NCBI-ProteinID: XP_002079103
UniProt: B4QAD3
Position
2L
AA seq 288 aa AA seqDB search
MRLRLQVLVALVTFSSITGSLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCDK
FSGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFI
SLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLQYSEF
LPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRR
PIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcgcttgcaagtcctggtggccctggtaaccttctcgtccattaccggctca
ctggcctacaaaccggtggtcatcctccatggaattctatccggagccgaatcgatggcc
tctctggttcgggaaatcgaagagtttcatcctggtaccatcgtctacaactgcgacaag
ttcagtggatggtacagcttggagaacgcctggcgacaggtcgatcaggtcagggattac
ctcaatgaggtaggcaaactgcatccagagggcatcattgtgctgggatactcgcaagga
ggcctcttggctcgggcggccatccaaagtctgcccgagcacaatgtgaagacctttata
tctctatcctcgccacaggcggggcaatacggcactagcttcctgcatctgatatttccc
gatttggcagctaagacagccttcgagttgttctactcgcgcgtgggacagcacacctcg
gttggtggctactggaacgatccgcagaggcaggatctctatctgcagtacagcgaattc
ttgccactgatcaataatgagaagaagacctccaactccacttccttcaagatgggaatg
gtgcggctgaacaagttggtgatgatcggcggaccaaacgacgatgtgattacaccgtgg
caatcgagccactttgggtacttcgacgagaacatggatgtgattccttttattaggcga
ccgattttcaccagcgactccattggcatcaggacgcttcaggaggccggcaagctcatc
attgtggtcaaaccccatgttcatcatcttgcctggcacacgcgaagggatgtcatccac
gaagtgatatttccatatctggactga

DBGET integrated database retrieval system