KEGG   Drosophila simulans: Dsimw501_GD23862Help
Entry
Dsimw501_GD23862  CDS       T01065                                 

Gene name
Dsim_GD23862
Definition
(RefSeq) GD23862 gene product from transcript GD23862-RB
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dsi  Drosophila simulans
Pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsimw501_GD23862 (Dsim_GD23862)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dsimw501_GD23862 (Dsim_GD23862)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dsimw501_GD23862 (Dsim_GD23862)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dsimw501_GD23862 (Dsim_GD23862)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 2464 aa AA seqDB search
MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHSAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADLASS
KDQKGVTRDDRIHGGLVVFNELFRCANATWERRYTSLKTLFPKTQHNKFLEASSSSSMGS
QLNTLVPRLKVPFIDKLGSSQTHLGEGEHHKGVAKFASHNVLESAYAQEILQEHYTNICD
NVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVEKYLQTCVSHLMQILRGKEKDRTVAYI
TIGYIAVAVQSAIEVHLSSIMTSVKVALPAKDLTSKRKVPVDPAVFACITLLAHAVKSEI
ADDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAVLPYT
ALPTIAIDGSLMQNGDGATTVLALKTLGTFNFEEQNMLDFVQRCADFFIVHEQQEIRLEA
VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETFD
GKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSINPAYVMPKLRTTMIELITDLKYS
GMSRNKEQSAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLA
EVNGGSDEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDE
SQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIKC
VPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTINT
PLQNTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGST
LGYYLPLILPPIVKLFDSPYVPRQVSLVALETINNLACQLDFTDFSSRIIHPLVRVLDAE
PELRDQAMTTLRSLVKQLGNKYLVFVPMVQRTLNKHRIADPEYEDLLSRIKSNSTRADSY
GAGESALRPARSKNNEPFVTDRNSNNKNLQVTTNELRTAWQVTRRVSKDDWVEWLKRLSI
GLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELSPDLKNELTQSLIQALQVTD
MPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDSQVF
ESLILINNKLQQREAAEGLLTRYRNAANELNVQGRWYEKLHNWDEALEHYERNLKTNSSD
LEARLGHMRCLEALGDWSELSNVTKHEWETFGAEAKSRAGPLAAVAAWGLQDWEAMREYV
RCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVCV
QMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHDDIHTW
LKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPNQPLPCNQPQVTYAYTKYMAANNQLQEA
YEQLTHFVSTYSQELSCLPPEALKQQDQRLMARCYLRMATWQNKLQDSIRPDAIQGALEC
FEKATSYDPNWYKAWHLWAYMNFKVVQAQKSALDKQQPPGASMGLDSDLMIIQRYAVPAV
QGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTWLQVIPQLIAR
IDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDSMTKHSPTL
VEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAMLERGPQTL
KETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQLTSLELPY
VSPKLTTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSKQRPRKLCIRGSNGKDYMYL
LKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGWVPHCDT
LHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDLAKLLWL
KSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVA
MTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAFVYDP
LLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDPTLQQGGL
HNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNENLCQCYIGW
CPFW
NT seq 7395 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacgtcggtggtgcagcagttcgtcaacgggcttaagtcccgcaaccggaat
gtccagaacaaggccacccaggatctgctcttctatgtaaagaccgagctgcgcgagatg
tcccaggaggagctggcgcaattcttcgacgagttcgaccaccacattttcacgatggtg
aatgcgacggacatcaatgagaagaaaggcggtgccttggccatgaagtgcctgattaac
tgcgagggcagtctaactgccagaaaaggcatttcgccctatctcaaccgcctacgcgat
cttctgctgatcaacgatgtgtccgtcatggagattgccgcccgctccctggtcaagttg
gccaacatgcccacctccaagggcgccgattcctttgactttgatattaagaaggctttt
gaggtgctcagaggcgagagacaagagtaccgccgccattcagccgtctttatcctccgt
gagctggcgatcgccctgccgacatacttctaccagcacatcttgaccttcttcgaggtt
atctttaacgccatcttcgatcccaaacctgctatacgagagtcagctggcgaggctttg
agggcggctttgattgtcaccgctcagcgagagagcaccaaacagtccagtgaaccacag
tggtatagaatctgctatgacgaggcgaatgggagcttcaatgcggacttggcctctagc
aaggatcagaagggcgtgacccgagatgatcgcattcacggtggcctcgtcgtcttcaac
gagctctttcgctgtgccaatgccacctgggagcggcgctacacgtcgctgaagacgctg
ttccccaagacccaacacaacaagttcctggaggccagcagttcgtcgagtatgggttcc
cagctgaatactctagtgccgcggctaaaggtgcccttcattgacaagctcggcagctcc
caaacgcatttgggcgagggagagcatcacaaaggagttgccaagttcgcgagccacaac
gtactggagtccgcctatgctcaggagatccttcaggagcactacaccaacatttgcgac
aatgttttggagcagcgaacttcgaagtctccgtatgtacagcaggcactccttcaaatt
ctgccccgcttggctgcttttaaccgcgcggtgtttgtggaaaaataccttcagacatgt
gtgtcgcacttaatgcagatcctgcggggcaaggagaaggatcgcacggtggcctacatt
accattgggtacatagctgtggcggtgcagagtgcgatcgaagttcatctatccagtata
atgaccagcgtgaaggtcgctttgccggcaaaggatttgaccagcaaacgaaaggtacca
gtggatcctgcggtctttgcctgcataacgctccttgcgcatgccgttaagtcggagatc
gccgacgatgttaaggatatccttgagcagatgttctacacgggtctctcgccagctctg
actgtttgcctaagagaactctccgagaatgtgccgcagctaaagtcggccattacagaa
ggattgatcggaatcctatcccaggtgctgatgaacaaggcggctgttttaccatacact
gctttgccaacgatcgccatcgatggctcgctaatgcagaatggtgacggagccaccaca
gtgctggcacttaaaacgctgggtaccttcaactttgaggagcaaaacatgctggacttt
gtgcaacgatgcgctgacttcttcatcgttcatgagcagcaggagattcgtttggaggca
gtgcaaacatgcacacgactccttaaattggcagtgcaatcctctgaaagtatggagaac
tccaagaccctcagcgacaccgtttcccatgtgattgagcgcttgcttatggtggccatt
actgatatggactgtaatgtgcgaatacgtattctacgttcgctggacgagacctttgat
gggaaacttgctcagccagagtctctaaattcgctatttattacgctgcacgacgaaatc
tttgagatccgggagctggcaatggtgaccattggtagattgtcgtccataaacccggct
tatgtgatgcccaagctaagaaccaccatgatcgagttgatcacggatctgaagtactcg
ggtatgagtcggaacaaggagcagagcgcaaagatgcttgaccatctggtgataagcacg
cccaggctaatatcctcgtacatgaatccgatcctcaaagccttagtgcccaagttacat
gagccggaatcgaatccaggagttattttgaatgtgcttcgcactattggtgatctagca
gaggtaaatggaggctccgatgaaatggaattgtgggcagatgaccttctgtccattttg
ctcgaaatgctgggcgacgctggcagtccggataagcgaggagtggctctgtggaccttg
ggacagttaatcagtgcaacgggcagagtggttagcccatatcacaagtaccccgtgctc
atagacattttgattaatttccttaaaacggaacaacgtcgatccatacgaagggaaacg
atacgagtgctgggcttgttgggagccatggatccttacaagcacaagatgaacaagggc
ttgattgatagccaaaaggataatgttttaatagcatactccgatggcaaagtcgatgaa
agtcaggacatctccaccgctgagttgctggtcaacatgggcaacgcattggatgagtat
tatcccgctgtggccatagctgccttgatgaggattctacgggatcccacgttaagtaca
cgtcacaccagcgtggtgcaggcggttacttttatcttccagagcctgggcatcaaatgt
gtgccgtacttggcccaagtgcttccaaatttgctggacaatgtacgcactgcggataat
aatctgagggagtttctcttccagcagctcgccattctggtggcttttgtgaagctgcac
atcatcagctacatgggagatattttcaagttgatcaaagagttttggaccataaatacg
cctctgcaaaacactctaatcaatttgatagaacagatcgccgtggccttgggatgcgag
tttagggattatttggcggagctgatcccacaaattctgcgagtattgcagcacgataac
tccaaggatagaatggtcacgagaaggctgctccaagctctccaaaagtttggcagcact
ttgggttactaccttccgctgattttgcctccgatcgtgaaactcttcgattctccgtat
gtaccacggcaggtgtcactggtagccctggaaacgatcaacaatctagcctgtcagctg
gacttcaccgacttttcctcgcgcatcatacatccgttggttcgagtgctggacgctgag
ccagagcttcgggaccaagctatgacaacccttcgctcactggtaaagcaactgggcaat
aagtacctcgtgttcgtgcctatggtccagcgcactctcaacaagcatcgcattgcggat
cccgagtacgaggacctactgagtcggattaagtccaacagcacacgggcggattcctat
ggtgccggggagtcagctctgcggccggccaggtccaaaaacaacgagccatttgtgacg
gaccgaaatagcaataataaaaatctgcaggtcaccacaaacgaactacgaacggcgtgg
caggtgacgcggcgggtgtccaaggacgactgggttgagtggctaaagcggttgtccatt
gggctgctaaaggaatcgccttcgcacgcactgagagcctgtcgttcgttggcccaagag
tacgatacgctgttgcgagatctttttaacgccgcatttatctcctgttggacggaactt
tcgccggatttgaaaaacgagctaacacagtcgctgattcaagccctgcaagttaccgac
atgccggaaatcacccagacaatcctcaacttggcggagtttatggagcactgcgaccgg
gatccaataccaatagaaactaagctattgggtactcgagcgatggcttgcagagcttat
gcgaaggcattgcgctacaaggaggaggagttccttctgcgagaagattcccaagttttt
gagtccttgattttaatcaacaacaagctgcagcaaagggaagcagcggaaggtctgctc
acaaggtatcggaatgcagccaacgaactaaatgttcaaggaagatggtatgaaaaactt
cacaattgggatgaggcgctggaacactatgaaaggaatctaaagacgaattcatcagac
ttggaggcgcgactcggtcacatgcgctgcttggaggccctcggagattggtcggagctg
agcaacgtgaccaagcacgagtgggaaaccttcggtgcggaggccaaatcaagagcagga
cccttggctgcggtggccgcctggggtctccaggattgggaggcgatgcgggagtacgta
aggtgtataccagaggatacccaagatggaagctactatcgtgctgtcctcgccgtgcat
catgacgactttgagaccgcacagcgcctcattgacgaaacgagggacctcctggacacg
gagctcacatcaatggcgggcgagtcttatgaaagagcttacggagccatggtttgtgta
caaatgctggcggagctggaggaggtcatccaatacaagctgatccccgagaggcgagag
cccttaaagaccatgtggtggaagcgtcttcaaggaggccagcgactagtagaagactgg
cgaaggatcatccaggtgcactcgctggtggtaaaaccgcacgacgacatacacacctgg
ctgaagtacgctagtctgtgcaggaagagcggctccctgcacttgtcccataaaactctg
gtgatgctgctaggcaccgatcccaagcttaatccgaaccagccactaccttgtaatcaa
ccgcaggtgacctatgcgtacaccaagtacatggctgccaataatcagctgcaggaagcc
tacgagcagttgacgcacttcgtcagcacctatagtcaggagctaagctgtttacctccg
gaagcactaaagcaacaagatcagcgactcatggcccgctgctatctgcgcatggccacc
tggcagaacaagctgcaggacagcatcagaccggatgccattcaaggcgctctcgagtgc
ttcgaaaaagccaccagctatgatcccaactggtacaaggcctggcatctgtgggcatac
atgaacttcaaggtggtgcaggcccaaaaatcggcgctggacaaacaacagcctccggga
gccagcatgggcctcgacagtgatctaatgatcatacagcgatacgccgtaccggcagtt
cagggattcttccgttcaatcagccttataaaaggcaattcgctgcaggatacgctacgg
ttgttaactctttggtttgactatggcaaccatgcggaggtgtacgaggcgctgctctct
ggaatgaagctgatcgagatcaacacctggcttcaggttatcccgcagcttattgcccgc
atcgatacccaccgtcagttggtgggtcaactgatccaccagctccttatggacatagga
aagaatcacccgcaggctctggtctatcctctgacagtcgcctccaagtcagcatcattg
gcgcgcaggaacgccgcctttaagatcctcgactcgatgacgaaacactcgcccaccttg
gtggagcaggcggtcatgtgcagtgaggagctcatccgagtggcgattctgtggcacgaa
cagtggcacgaaggtttggaggaagcttcgcgactttactttggtgatcgcaacgtaaag
ggcatgttcgagattttggagccactgcatgctatgctggagaggggaccgcaaacgctc
aaggagacatccttctcgcaggcctatggacgcgagctgacggaggcgtacgagtggtcg
cagcggtacaagacatcggcggtggtgatggatctggatcgagcgtgggacatctactat
cacgtcttccaaaagatctcgcgccagctgccacagcttacctctctggagctgccgtat
gtctcgcccaaactgacgacgtgcaaagatctcgaactggccgtgcccgggtcctacaat
cctggccaggagctcatccggattagtatcattaaaaccaacctacaggtgattacttcc
aagcagcgcccacgaaaactgtgcatacgcggctccaatggcaaggactatatgtacctt
ctaaagggacacgaggatcttcgtcaggacgaacgcgtgatgcagctattctccctggtg
aacacattgctgttggatgaccccgacactttccgtcgtaacttggccatccagcggtat
gcggttatcccgctcagtaccaactcgggtctgattggttgggtgccacattgtgacacc
ctgcatacgctaatccgcgactaccgcgacaagaaaaaggtgccacttaatcaggagcat
cgcactatgcttaattttgcgccagactatgatcacctcacgctgatgcagaaggtggaa
gtattcgagcatgcgttgggtcagacgcaaggcgacgacttggccaagctgttgtggctc
aagtctccgtcctccgaattgtggtttgagcggagaaacaactacacccgctcactggca
gtcatgtcaatggttggttatatcctgggtctgggcgatcgtcatccatcgaaccttatg
ctggatcgaatgagcggcaagatactgcacatagactttggcgactgcttcgaggtggcc
atgacgcgcgaaaagtttcccgaaaagatacccttccgtctcacccggatgctaatcaag
gcgatggaggtcacgggcatcgagggcacctacagacgcacttgcgaaagcgtgatgctg
gtgcttcgccgcaacaaggattccctgatggctgtgctggaggcctttgtctacgatccg
ctgctcaactggagactgttggatgttgacaagaagggcaacgatgcggtggctggggcg
ggtgctcccggtggacgtggcggttccggaatgcaggacagtctcagtaactccgtggag
gactccctgcccatggccaagtcgaagccatacgatccgacgctgcagcaaggcggccta
cacaacaacgtggccgacgagacgaacagcaaagccagccaggtaatcaagcgggtcaag
tgcaagctaacaggcaccgacttccagacggaaaagagcgtaaacgagcagtcgcaggtg
gagctgctcatccagcaggcgaccaataacgagaacctttgccagtgctacattggctgg
tgtccgttttggtag

DBGET integrated database retrieval system