KEGG   Drosophila simulans: Dsim_GD23862Help
Entry
Dsim_GD23862      CDS       T01065                                 

Definition
GD23862 gene product from transcript GD23862-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dsi  Drosophila simulans
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsim_GD23862
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dsim_GD23862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 2168 aa AA seqDB search
MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHSAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADLASS
KDQKGVTRDDRIHGGLVVFNELFRCANATWERRYTSLKTLFPKTQHNKFLEASSSSSMGS
QLNTLVPRLKVPFIDKLGSSQTHLGEGEHHKGVAKFASILRGKEKDRTVAYITIGYIAVA
VQSAIEVHLSSIMTSVKVALPAKDLTSKRKVPVDPAVFACITLLAHAVKSEIADDVKDIL
EQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAVLPYTALPTIAID
GSLMQNGDGATTVLALKTLGTFNFEEQNMLDFVQRCADFFIVHEQQEIRLEAVQTCTRLL
KLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETFDGKLAQPES
LNSLFITLHDEIFEIRELAMVTIGRLSSINPAYVMPKLRTTMIELITDLKYSGMSRNKEQ
SAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLAEVNGGSDE
MELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPVLIDILINFL
KTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDESQDISTAE
LLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIKCVPYLAQVL
PNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTINTPLQNTLIN
LIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGSTLGYYLPLI
LPPIVKLFDSPDEVGWEWEEHCDRDPIPIQTKLLGTRAMACRAYAKALRYKEEEFLLRED
SQVFESLILINNKLQQREAAEGLLTRYRNAANELNVQGRWYEKLHNWDEALEHYERNLKT
NSSDLEARLGHMRCLEALGDWSELSNVTKHEWETFGAEAKSRAGPLAAVAAWGLQDWEAM
REYVRCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGA
MVCVQMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHDD
IHTWLKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPNQPLPCNQPQVTYAYTKYMAANNQ
LQEAYEQLTHFVSTYSQELSCLPPEALKQQDQRLMARCYLRMATWQNKLQDSIRPDAIQG
ALECFEKATSYDPNWYKAWHLWAYMNFKVVQAQKSALDKQQPPGASMGLDSDLMIIQRYA
VPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTWLQVIPQ
LIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDSMTKH
SPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAMLERG
PQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQLTSL
ELPYVSPKLTTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSKQRPRKLCIRGSNGKD
YMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGWVP
HCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDLAK
LLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDC
FEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAF
VYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDPTLQ
QGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNENLCQC
YIGWCPFW
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacgtcggtggtgcagcagttcgtcaacgggcttaagtcccgcaaccggaat
gtccagaacaaggccacccaggatctgctcttctatgtaaagaccgagctgcgcgagatg
tcccaggaggagctggcgcaattcttcgacgagttcgaccaccacattttcacgatggtg
aatgcgacggacatcaatgagaagaaaggcggtgccttggccatgaagtgcctgattaac
tgcgagggcagtctaactgccagaaaaggcatttcgccctatctcaaccgcctacgcgat
cttctgctgatcaacgatgtgtccgtcatggagattgccgcccgctccctggtcaagttg
gccaacatgcccacctccaagggcgccgattcctttgactttgatattaagaaggctttt
gaggtgctcagaggcgagagacaagagtaccgccgccattcagccgtctttatcctccgt
gagctggcgatcgccctgccgacatacttctaccagcacatcttgaccttcttcgaggtt
atctttaacgccatcttcgatcccaaacctgctatacgagagtcagctggcgaggctttg
agggcggctttgattgtcaccgctcagcgagagagcaccaaacagtccagtgaaccacag
tggtatagaatctgctatgacgaggcgaatgggagcttcaatgcggacttggcctctagc
aaggatcagaagggcgtgacccgagatgatcgcattcacggtggcctcgtcgtcttcaac
gagctctttcgctgtgccaatgccacctgggagcggcgctacacgtcgctgaagacgctg
ttccccaagacccaacacaacaagttcctggaggccagcagttcgtcgagtatgggttcc
cagctgaatactctagtgccgcggctaaaggtgcccttcattgacaagctcggcagctcc
caaacgcatttgggcgagggagagcatcacaaaggagttgccaagttcgcgagcatcctg
cggggcaaggagaaggatcgcacggtggcctacattaccattgggtacatagctgtggcg
gtgcagagtgcgatcgaagttcatctatccagtataatgaccagcgtgaaggtcgctttg
ccggcaaaggatttgaccagcaaacgaaaggtaccagtggatcctgcggtctttgcctgc
ataacgctccttgcgcatgccgttaagtcggagatcgccgacgatgttaaggatatcctt
gagcagatgttctacacgggtctctcgccagctctgactgtttgcctaagagaactctcc
gagaatgtgccgcagctaaagtcggccattacagaaggattgatcggaatcctatcccag
gtgctgatgaacaaggcggctgttttaccatacactgctttgccaacgatcgccatcgat
ggctcgctaatgcagaatggtgacggagccaccacagtgctggcacttaaaacgctgggt
accttcaactttgaggagcaaaacatgctggactttgtgcaacgatgcgctgacttcttc
atcgttcatgagcagcaggagattcgtttggaggcagtgcaaacatgcacacgactcctt
aaattggcagtgcaatcctctgaaagtatggagaactccaagaccctcagcgacaccgtt
tcccatgtgattgagcgcttgcttatggtggccattactgatatggactgtaatgtgcga
atacgtattctacgttcgctggacgagacctttgatgggaaacttgctcagccagagtct
ctaaattcgctatttattacgctgcacgacgaaatctttgagatccgggagctggcaatg
gtgaccattggtagattgtcgtccataaacccggcttatgtgatgcccaagctaagaacc
accatgatcgagttgatcacggatctgaagtactcgggtatgagtcggaacaaggagcag
agcgcaaagatgcttgaccatctggtgataagcacgcccaggctaatatcctcgtacatg
aatccgatcctcaaagccttagtgcccaagttacatgagccggaatcgaatccaggagtt
attttgaatgtgcttcgcactattggtgatctagcagaggtaaatggaggctccgatgaa
atggaattgtgggcagatgaccttctgtccattttgctcgaaatgctgggcgacgctggc
agtccggataagcgaggagtggctctgtggaccttgggacagttaatcagtgcaacgggc
agagtggttagcccatatcacaagtaccccgtgctcatagacattttgattaatttcctt
aaaacggaacaacgtcgatccatacgaagggaaacgatacgagtgctgggcttgttggga
gccatggatccttacaagcacaagatgaacaagggcttgattgatagccaaaaggataat
gttttaatagcatactccgatggcaaagtcgatgaaagtcaggacatctccaccgctgag
ttgctggtcaacatgggcaacgcattggatgagtattatcccgctgtggccatagctgcc
ttgatgaggattctacgggatcccacgttaagtacacgtcacaccagcgtggtgcaggcg
gttacttttatcttccagagcctgggcatcaaatgtgtgccgtacttggcccaagtgctt
ccaaatttgctggacaatgtacgcactgcggataataatctgagggagtttctcttccag
cagctcgccattctggtggcttttgtgaagctgcacatcatcagctacatgggagatatt
ttcaagttgatcaaagagttttggaccataaatacgcctctgcaaaacactctaatcaat
ttgatagaacagatcgccgtggccttgggatgcgagtttagggattatttggcggagctg
atcccacaaattctgcgagtattgcagcacgataactccaaggatagaatggtcacgaga
aggctgctccaagctctccaaaagtttggcagcactttgggttactaccttccgctgatt
ttgcctccgatcgtgaaactcttcgattctccggacgaggtgggatgggagtgggaggag
cactgcgaccgggatccaataccaatacaaactaagctattgggtactcgagcgatggct
tgcagagcctatgcgaaggcattgcgctacaaggaggaggagttccttctgcgagaagat
tcccaagtttttgagtccttgattttaatcaacaacaagctgcagcaaagggaagcagcg
gaaggtctgctcacaaggtatcggaatgcagccaacgaactaaatgttcaaggaagatgg
tatgaaaaacttcacaattgggatgaggcgctggaacactatgaaaggaatctaaagacg
aattcatcagacttggaggcgcgactcggtcacatgcgctgcttggaggccctcggagat
tggtcggagctgagcaacgtgaccaagcacgagtgggaaaccttcggtgcggaggccaaa
tcaagagcaggacccttggctgcggtggccgcctggggtctccaggattgggaggcgatg
cgggagtacgtaaggtgtataccagaggatacccaagatggaagctactatcgtgctgtc
ctcgccgtgcatcatgacgactttgagaccgcacagcgcctcattgacgaaacgagggac
ctcctggacacggagctcacatcaatggcgggcgagtcttatgaaagagcttacggagcc
atggtttgtgtacaaatgctggcggagctggaggaggtcatccaatacaagctgatcccc
gagaggcgagagcccttaaagaccatgtggtggaagcgtcttcaaggaggccagcgacta
gtagaagactggcgaaggatcatccaggtgcactcgctggtggtaaaaccgcacgacgac
atacacacctggctgaagtacgctagtctgtgcaggaagagcggctccctgcacttgtcc
cataaaactctggtgatgctgctaggcaccgatcccaagcttaatccgaaccagccacta
ccttgtaatcaaccgcaggtgacctatgcgtacaccaagtacatggctgccaataatcag
ctgcaggaagcctacgagcagttgacgcacttcgtcagcacctatagtcaggagctaagc
tgtttacctccggaagcactaaagcaacaagatcagcgactcatggcccgctgctatctg
cgcatggccacctggcagaacaagctgcaggacagcatcagaccggatgccattcaaggc
gctctcgagtgcttcgaaaaagccaccagctatgatcccaactggtacaaggcctggcat
ctgtgggcatacatgaacttcaaggtggtgcaggcccaaaaatcggcgctggacaaacaa
cagcctccgggagccagcatgggcctcgacagtgatctaatgatcatacagcgatacgcc
gtaccggcagttcagggattcttccgttcaatcagccttataaaaggcaattcgctgcag
gatacgctacggttgttaactctttggtttgactatggcaaccatgcggaggtgtacgag
gcgctgctctctggaatgaagctgatcgagatcaacacctggcttcaggttatcccgcag
cttattgcccgcatcgatacccaccgtcagttggtgggtcaactgatccaccagctcctt
atggacataggaaagaatcacccgcaggctctggtctatcctctgacagtcgcctccaag
tcagcatcattggcgcgcaggaacgccgcctttaagatcctcgactcgatgacgaaacac
tcgcccaccttggtggagcaggcggtcatgtgcagtgaggagctcatccgagtggcgatt
ctgtggcacgaacagtggcacgaaggtttggaggaagcttcgcgactttactttggtgat
cgcaacgtaaagggcatgttcgagattttggagccactgcatgctatgctggagagggga
ccgcaaacgctcaaggagacatccttctcgcaggcctatggacgcgagctgacggaggcg
tacgagtggtcgcagcggtacaagacatcggcggtggtgatggatctggatcgagcgtgg
gacatctactatcacgtcttccaaaagatctcgcgccagctgccacagcttacctctctg
gagctgccgtatgtctcgcccaaactgacgacgtgcaaagatctcgaactggccgtgccc
gggtcctacaatcctggccaggagctcatccggattagtatcattaaaaccaacctacag
gtgattacttccaagcagcgcccacgaaaactgtgcatacgcggctccaatggcaaggac
tatatgtaccttctaaagggacacgaggatcttcgtcaggacgaacgcgtgatgcagcta
ttctccctggtgaacacattgctgttggatgaccccgacactttccgtcgtaacttggcc
atccagcggtatgcggttatcccgctcagtaccaactcgggtctgattggttgggtgcca
cattgtgacaccctgcatacgctaatccgcgactaccgcgacaagaaaaaggtgccactt
aatcaggagcatcgcactatgcttaattttgcgccagactatgatcacctcacgctgatg
cagaaggtggaagtattcgagcatgcgttgggtcagacgcaaggcgacgacttggccaag
ctgttgtggctcaagtctccgtcctccgaattgtggtttgagcggagaaacaactacacc
cgctcactggcagtcatgtcaatggttggttatatcctgggtctgggcgatcgtcatcca
tcgaaccttatgctggatcgaatgagcggcaagatactgcacatagactttggcgactgc
ttcgaggtggccatgacgcgcgaaaagtttcccgaaaagatacccttccgtctcacccgg
atgctaatcaaggcgatggaggtcacgggcatcgagggcacctacagacgcacttgcgaa
agcgtgatgctggtgcttcgccgcaacaaggattccctgatggctgtgctggaggccttt
gtctacgatccgctgctcaactggagactgttggatgttgacaagaagggcaacgatgcg
gtggctggggcgggtgctcccggtggacgtggcggttccggaatgcaggacagtctcagt
aactccgtggaggactccctgcccatggccaagtcgaagccatacgatccgacgctgcag
caaggcggcctacacaacaacgtggccgacgagacgaacagcaaagccagccaggtaatc
aagcgggtcaagtgcaagctaacaggcaccgacttccagacggaaaagagcgtaaacgag
cagtcgcaggtggagctgctcatccagcaggcgaccaataacgagaacctttgccagtgc
tacattggctggtgtccgttttggtag

DBGET integrated database retrieval system