KEGG   Drosophila simulans: Dsimw501_GD23919Help
Entry
Dsimw501_GD23919  CDS       T01065                                 

Gene name
Dsim_GD23919
Definition
(RefSeq) GD23919 gene product from transcript GD23919-RA (EC:2.7.11.24)
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dsi  Drosophila simulans
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsimw501_GD23919 (Dsim_GD23919)
   04068 FoxO signaling pathway
    Dsimw501_GD23919 (Dsim_GD23919)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dsimw501_GD23919 (Dsim_GD23919)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsimw501_GD23919 (Dsim_GD23919)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dsimw501_GD23919 (Dsim_GD23919)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 365 aa AA seqDB search
MSRKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQ
SAVHAKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNII
RTQKLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAES
EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIME
VLGTPADEFMSRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADKRI
TAEQALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEKWREMVFSEVTAFKPTAAFAEL
LPKEQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcaaaatggccaagttctacaagctggacatcaatcgcaccgagtgggagatc
ccggagacataccagaacctgcaacccgtgggtcagggtgcctacggccaggtctgcaag
gccgtggtccgcggaaccagcacgaaggtggccatcaagaagctggccaggcccttccag
tcggcggtccatgcgaagcgcacctaccgggaattgcggctgttgaagcacatggatcac
gagaacgtcattggtctgctggatgtctttcatccaggacagcccgccgattctctggat
cagttccagcaggtgtacatggtgacccacttgatggacgccgatctgaacaacataata
cgcacgcagaagctgtccgatgatcatgtccagtttctggtctaccaaatcctgcgcggt
ctgaagtacatccacagcgctggggtcatccatcgtgatctaaagccatcgaacattgcg
gtaaacgaggactgtgagcttcgcatcctggacttcggcttggcccgtcccgcagaaagc
gagatgaccgggtacgtggctacgcgatggtaccgcgcgcctgagatcatgctcaattgg
atgcactacaaccagacggtggacatctggtcggtgggctgcatcatggccgaactgctg
actgggcgcacactgttccctggaaccgatcacatccatcagctgaacctcatcatggaa
gtgctgggcacgccagctgatgagttcatgagccgcatctcctcggagagcgctaggaac
tatattcgttcactgccggtgatgccacgccgcaatttccgcgacatcttccgcggtgcc
aatccgctggccatcgatttgctggagaaaatgcttgaacttgacgccgacaagcgcatc
accgccgagcaggcgctggcccatccgtacatggagaagtaccacgatccaaccgatgag
cagaccgccgcgctctacgaccagagcttcgaggagaacgagctgccggtggagaagtgg
cgggagatggtcttcagcgaggtgacggccttcaagcccacagccgccttcgctgagctc
ctgcccaaggagcagtaa

DBGET integrated database retrieval system