KEGG   Drosophila simulans: Dsim_GD23927Help
Entry
Dsim_GD23927      CDS       T01065                                 

Gene name
Dsim_Sos
Definition
GD23927 gene product from transcript GD23927-RA
Orthology
K03099  
son of sevenless
Organism
dsi  Drosophila simulans
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsim_GD23927 (Dsim_Sos)
   04630 Jak-STAT signaling pathway
    Dsim_GD23927 (Dsim_Sos)
   04068 FoxO signaling pathway
    Dsim_GD23927 (Dsim_Sos)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dsim_GD23927 (Dsim_Sos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 1595 aa AA seqDB search
MFSGPSGHAHTISYGGGIGLGTGGGGGSGGGGGSQGGGGGVGIGGGGVAGLQDCDGYDFT
KCENAARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDV
EEKVNKSFPAPIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLV
AVLEYISADILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLP
AQRASATYEETVKELIHDEKQYQRDLHMIIRVFREELVKIVSDPRELEPIFSNIMDIYEV
TVTLLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLLS
KPGASSLTTAGHGFRDAVKYYLPKLLLVPICHAFVYFDYIKHLKDLSSSQDDIESFEQVQ
GLLHPLHCDLEKVMASLSKERQVPVSGRVRRQLAIERTRELQMKVEHWEDKDVGQNCNEF
IREDSLSKLGSGKRIWSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRRV
DINDRPDSDDLKNSFELAPRMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSILQ
DIERKHPLRMPSPEIYKFAVPDSGDNIVLEERESAGVPMIKGATLCKLIERLTYHIYADP
TFVRTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDTGAAGAGGMGGVGGDKEHKNSH
REDWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLEHVNGKSMRKWV
DSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLE
FEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIM
QRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDHL
KKYQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQY
QNQPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPHI
PLKSPGIKPRRQNQTNSSSKLSNSTSSVAAAAAASSTATTIATASAPSLHASSIMDASTA
AAANAGSVTLAGEQSPQHNPHAFSVFAPVIIPERNTSSWSGTPQHTRTDQNNGEVSVPAP
HLPKKPGAHVWANNNTTLASASAMDVVFSPALPEHLPPQSLPDSNPFASDTEAPPSPLPK
LVVSPRHETGNRSPFHGRMQNSPTHSTASTVTLTGMSTSGGEEFCAGGFYFNSAHQGQPG
AVPISPHVNVPMATNMEYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELSP
PPIPPRLNHSTGISYLRQSHGKCKEFVGNSSLLLPNTSSIMIRRNSAIEKRAAATTQPNQ
AAAGPISTTLVTVSQAVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHPVESTS
SSYAHQLRMRQQQQQQTHPAIYSQHHQHHATHLPHHPHQHHSNPTQSRSSPKEFFPIATS
LEGTPKLPPKPSLSANFYNNPDKGTMFLYPSTNEE
NT seq 4788 nt NT seq  +upstreamnt  +downstreamnt
atgttctcggggcccagcggccatgcccacaccattagctacgggggcgggatcggtctg
ggcaccggaggcggcggcggcagcggtggtggtggtggctcccagggcggaggcggtggt
gttggcattggcggcggtggcgtggctgggctgcaggattgcgatggctatgacttcacc
aagtgcgagaatgctgcgagatggcggggcttgtttacgccgtcgctgaagaaggtgctg
gagcaagtgcatccacgggtcaccgccaaggaggacgcactgctgtatgtggagaaactc
tgcctgcggctgctggccatgctgtgcgccaagccgctgccccactccgtgcaggatgtg
gaggagaaggtgaacaagtcctttccagcgcccatcgatcagtgggcgctcaacgaggca
aaggaggtgatcaactcgaagaaacgcaagtctgtcctgcccacggaaaaggtgcacacg
ctgctccagaaggatgtgctgcagtacaagatcgatagctccgtgtccgccttcctggtg
gccgtgctcgagtacatctcagcggacatactcaaaatggccggcgactatgtgatcaag
atcgcccactgcgagatcaccaaggaggacatcgaggtggtgatgaacgccgatcgcgtg
ctaatggacatgctcaaccagagcgaagcccacatcctgcccagtcccctgtcactgccc
gcgcagcgtgcaagtgccacctacgaggagacggtcaaggagctgatccacgacgagaag
cagtaccagcgcgacctgcacatgatcatacgcgtctttcgcgaggagctggtgaagatc
gtttccgatccgcgcgagctggaaccgatattctccaacataatggacatctacgaggtg
acggtcactctgctcggctccctggaggacgtcatcgagatgtcccaggagcagagtgct
ccctgcgtgggcagctgctttgaggaactggccgaggcggaggaattcgacgtgtacaag
aagtacgcctacgacgtgacctcgcaggcctcacgggatgctctcaacaatctcctgtcc
aagccaggggcctcatctctgaccacagccggccatggtttccgcgatgctgtcaaatac
tatttgcccaagctgcttctggtgcccatttgccacgccttcgtgtatttcgactacatc
aagcatctcaaggatctcagctcgtcgcaggacgacatcgagagcttcgaacaggtccag
ggcctgttgcatccactccactgcgatctcgaaaaggtaatggccagcctgtccaaggag
cgacaagttccggtcagcggtcgagtgcgccgccagctggccatcgagcgaacacgggag
ctccaaatgaaggtggagcactgggaggacaaggacgtgggccagaattgcaatgaattt
attcgagaggattcgctgagcaagcttggatcgggaaaacgaatctggagcgagcgcaag
gtattcctcttcgacgggctaatggtgctgtgcaaggcaaacaccaagaagcaaacacca
tcggcaggagcaacggcctacgactaccgactgaaggagaagtatttcatgcgacgcgtg
gatatcaacgatcgaccggacagcgatgatctaaagaacagctttgagttggcaccccgg
atgcagccgcccattgtgctgaccgccaagaatgcgcagcacaagcacgattggatggcg
gacctgcttatggtgatcaccaagtcgatgctggaccggcacttggacagcatactgcaa
gacatcgagcgaaagcacccgctgcggatgcccagtccggagatttacaagttcgcggtg
ccggacagcggtgacaatatcgtgttggaggagcgcgaaagcgcaggagtgccaatgatc
aagggagcgacgctttgcaagctaatcgagcgcctcacctatcacatctacgccgatccg
acctttgtgcgcaccttcctcaccacatatcgctacttctgctcgccgcagcaattgctg
cagctgctggtggaacgctttaacataccggatcccagcctggtctatcaagacacgggc
gcagcaggtgcgggtggaatgggcggcgttggcggtgacaaggagcacaagaactcgcat
cgcgaggactggaagcgatatcgcaaggagtacgtgcagccagtgcagtttcgagtgctc
aacgtgctgcgccattgggtcgaccatcatttttacgatttcgagaaggatcccatgttg
ctggagaagctgctcaacttcctggagcacgtgaatggcaaatcgatgcgcaagtgggtg
gattccgtgcttaagattgttcagagaaagaacgagcaggagaaaagcaataagaagatt
gtatacgcctatggccacgatccgccgcccatcgagcatcaccttagtgtacccaacgac
gagataacgctcctcaccctgcacccattggaactggcccgtcagctcacactgctggaa
ttcgagatgtacaagaatgtaaagccgtctgagttggtcggatcaccctggacgaaaaag
gacaaggaggtgaagagccctaacctactgaagatcatgaagcacaccacaaacgtgacc
cgctggattgagaaatccatcaccgaggcggagaactacgaggaacgcctggcaattatg
caacgcgcaatcgaagtgatgatggtgatgctggaattgaacaattttaatggaatcctc
tcgattgtcgcggctatgggcacggcatctgtttatcgactgcggtggacattccaggga
ttgcccgaacgctacagaaaattcttggaggaatgccgcgagctcagcgacgatcatctc
aagaagtatcaggagcgattgcgatccatcaatccgccttgtgtgccatttttcggtcgc
tacttgaccaacatactccacttggaggagggtaaccccgacctgctagccaacacagag
ctaattaacttttccaaacgacggaaagtggccgagattattggcgagattcaacagtac
cagaaccagccatactgcctcaacgaggagtccacaattcgacagttcttcgagcaactg
gatccgtttaacggactgtccgacaaacagatgtccgactatctctataacgaaagcctg
cgcattgagccaagaggctgcaagacggtgccgaaattccctcgaaaatggccgcacatt
ccgctcaaatcgccgggcatcaagccgcgtcgccagaatcagaccaacagcagtagcaag
ctgtcgaacagcacgtcgtccgtggcggcggcagcggcagcatcgtcaacggccaccaca
atagccacggcatcagcgccatctttgcacgcctccagcataatggatgcgtcaacagca
gcagcagctaatgctggatctgtaactctcgccggcgagcaaagtccgcagcacaatccg
cacgcgttctccgttttcgcccctgttattatacccgaacggaataccagcagctggagt
ggaacgccacagcacactcgaacggaccagaacaacggggaggtttcggtgccggcgcca
catctccccaagaaaccgggcgcgcatgtctgggctaacaacaacacgacactggccagt
gcgtcggcaatggatgttgtgttcagtccagcgctgccagaacatctgccaccgcagtcc
ttgccggacagcaatccattcgcatcggatacggaagctccgccgtcgccgctgcccaag
ctagtggtcagtccgcgtcacgaaaccggcaatcgatcaccattccatgggcgcatgcag
aacagcccaacgcatagcactgccagtaccgtgaccctaacaggcatgtctacatcgggc
ggggaggaattctgcgcgggtggcttctacttcaacagtgcccatcagggacagccgggg
gcagtgcccatctcgccgcatgtcaacgttccgatggccaccaatatggagtaccgagca
gtgccgcctccactgccacccagacgcaaggagcgcactgagagctgtgcggacatggcg
caaaagcgtcaggcgccagacgcacccacactacccccgcgtgatggcgaactcagtccg
ccgccgataccgccacggctcaaccattccacgggcatcagctacttgcgacagagccac
ggcaagtgcaaggagtttgtgggcaacagcagtctgctcctgcccaacaccagcagtatt
atgatacgccgcaactcggcgatcgagaagcgggcagcggcaactacccagccaaaccag
gcggcggcgggtcccatcagcacgaccctagtgaccgtgtcgcaggctgtggcgacggac
gaaccgctgccgctaccgatctcgccagcggcaagctcctcgacgaccacatcaccgctg
acacccgccatgtcgcccatgtcccccaacattcccagccatccggtggagagcacgtcg
agcagctatgcccaccaactgcgaatgcggcagcagcagcagcagcagacgcatccagcg
atctactcgcagcaccatcaacatcatgccacccatctgccgcaccatccgcaccagcac
cattcgaatccgacgcagtcgcgctcgtcccccaaggagttctttccgattgccacgagc
ctcgagggcacacccaaacttccaccaaaacctagtctaagcgctaacttctataacaat
ccagataaaggtacgatgtttctttacccaagtacaaacgaagaataa

DBGET integrated database retrieval system