KEGG   Drosophila simulans: Dsim_GD23959Help
Entry
Dsim_GD23959      CDS       T01065                                 

Definition
GD23959 gene product from transcript GD23959-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dsi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dsi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 947 aa AA seqDB search
MAEPLAAETKPLSNGNANGNAVGIAESASAVFQEKMKLQQEEPNEIAAVPKYGLKLKFDH
VWPEKRIQNVRASIRQTLPLVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIG
GIGGGTIGRGYAGEFCRFQMRPGIYEYNVVQANQFIVTIKDPKGCTIFQSLLSKCSTRDK
TSDPDADPDGERTKCQLPNCSSRAKQPLSAWHSNIEDSRCSYTGLYPRSWTEYDLSHYGV
RLTCRQVSPVIPHEYRESSQPCAVFVWSVENVCDQERKVSITFTFKNGTGNKKQDAEGGA
ESQLISEGNAKGVSIRQKIADMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKEH
GQLSEQPTSEALKTKDIGVAVCAQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYYT
KYFDDSGDSGPRICEYALRQYSTWERLIDAWQRPILNDETLPDWYKCAIFNQLYFISDGG
TIWLKCESSLGKELSYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVS
LQYDFKDAIAAELNDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDW
KDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYELYSQDNKRKNSADEK
QQNRKSASMYINETNGKVYLMDAIGYLKAMYASCKAILERTIEYDKDNDGLIENTKMPDQ
TYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLEEKLWNGS
YYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNI
GAANGFIANAGEPTKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKT
LSQRIGMNFETPEALYGEKRYRSIGYMRPLSILSMQVALERRRAQRD
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacctttagcagcggaaaccaagccgctgagcaacggaaacgccaatggaaac
gcggtgggaatcgccgaatccgccagtgccgtcttccaggagaagatgaagctccagcag
gaggagcccaacgagatcgcggcggtgccgaagtacggactcaagctgaagttcgaccat
gtgtggccggaaaagaggatccagaatgtgcgggcctccatcaggcaaacgctgcccctg
gtgcccctcgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgccgg
gtatacatggactactactacatggagaatggcaagcagatctatggagtgcccatcggc
ggaattggaggtggtacaattggcaggggctatgccggcgagttctgccgtttccagatg
cgtcccggcatctacgagtacaatgtggtgcaggccaatcagtttatcgttaccatcaag
gatcccaaaggatgcaccatctttcagagcctcctctccaagtgcagcaccagggacaag
accagcgatccggatgccgatccggatggggaaagaactaaatgtcaactgcccaattgc
agcagtcgcgccaagcagccgctgagtgcctggcactcgaacatcgaggactcgcgctgc
agctacacgggtctctatccccgctcctggacggagtacgatctgtcccactatggagtc
cgtctgacctgtcgccaggtgtcgccggtaataccgcatgagtaccgggagtccagccag
ccctgtgccgtcttcgtttggagcgtggagaatgtctgcgaccaggagcgcaaggtgtcc
atcacgttcacgttcaagaacggcactgggaataagaaacaggatgcggagggcggagcc
gagtcgcagctaatcagcgagggcaacgccaagggagtctccatcaggcagaagatcgct
gatatgccctgcagctataatctggcatgtagggtccttcccgagatcagcatcacgcgg
tgcccccagttcgatcccgccggcaacggggagcagttgtgggcacagctcaaggagcat
ggccagcttagcgagcagcccacctcagaggcactaaaaaccaaagatataggcgtggct
gtctgtgcccaggtagccctgaagccaatggcatcccacgatctggagtttgtgctggcc
tgggacatgccaaagattcagttccccaggaagatgcagacccacacacgctactacacc
aagtacttcgatgacagcggtgattcgggtcccaggatctgcgagtatgcactcaggcag
tattccacctgggagcgcttgattgatgcctggcaaagacccattctcaatgatgaaacc
cttcccgactggtacaagtgtgccatcttcaatcaactttacttcatctcggatggcgga
accatctggctgaaatgcgaatcctcgctgggcaaggaactgtcatatgatgatccccgt
ttggcttatggccgtttcggttacctggaaggccacgaataccgcatgtacaacacctac
gatgtccatttctatgcatcgccggctctggcccacctgtggcccaatcttcaggtcagt
ctgcagtacgacttcaaggatgccattgccgcagaactaaacgatactcgtaaaatgctt
tacgatggcaaggtgatgccacgcaaggtcaagaactgtgtgccccacgatctcggagat
cccgatgaggaacccttcaccttgatcaactgctacaacattcacgatgtgaatgactgg
aaggatcttaatacgaagtttgtgctgcaggtgtatcgggactactatgtcctcaatgaa
ctggcccaggcccaggcggataatgccagtaagttcagctccatcgagtttatcgataag
gagagcctatatgagctgtacagccaggacaacaagcgcaagaattcagctgatgaaaag
caacaaaaccgtaaatctgcatcgatgtacatcaacgaaaccaatggaaaggtgtatcta
atggacgccattggctacttgaaggccatgtacgcatcgtgcaaggccatcttggagcga
accattgaatacgataaggacaacgacggtctgatcgagaacacaaagatgccggaccag
acctacgactcctgggtgatggacgggccgagtgcctactgctccggcctctggctggct
gctctgcaggccatgtccgccatggctacaatcctggatcagccgaacgattgcctgcgc
tatcaggatattctggagaagggcaagcgatcgctggaggagaagctctggaatggcagc
tactatcgctttgatctttcgcacagtcatcgggatacgatcatggccgatcagttatgt
ggtcattggtatctgaagtcctgcggcttcgattacgagatctatccgaaggagaacgtg
cgtacggcccttaagaggatctatgacaacaatgtgatgggctttcatgagggcaatatc
ggagcggctaatggcttcatagccaatgccggcgaacccaccaagccgggccacgtggac
aacagcaacatccaggcggaggaggtgtggccaggtgtggtttacgctctggctgccacc
atgatacaggagggcatgttcgaggaagccttccagaccgccggcggaatgtacaagacc
ctgtcccagcgcatcggcatgaacttcgagaccccggaagcgttgtatggcgagaagcgc
tatcgctccattggctatatgcgtccgctgagcattttgtccatgcaggtggcattggag
cgacggcgagcccaacgagattaa

DBGET integrated database retrieval system