KEGG   Drosophila simulans: Dsim_GD23959Help
Entry
Dsim_GD23959      CDS       T01065                                 

Definition
GD23959 gene product from transcript GD23959-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dsim_GD23959
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsim_GD23959
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dsim_GD23959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 947 aa AA seqDB search
MAEPLAAETKPLSNGNANGNAVGIAESASAVFQEKMKLQQEEPNEIAAVPKYGLKLKFDH
VWPEKRIQNVRASIRQTLPLVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIG
GIGGGTIGRGYAGEFCRFQMRPGIYEYNVVQANQFIVTIKDPKGCTIFQSLLSKCSTRDK
TSDPDADPDGERTKCQLPNCSSRAKQPLSAWHSNIEDSRCSYTGLYPRSWTEYDLSHYGV
RLTCRQVSPVIPHEYRESSQPCAVFVWSVENVCDQERKVSITFTFKNGTGNKKQDAEGGA
ESQLISEGNAKGVSIRQKIADMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKEH
GQLSEQPTSEALKTKDIGVAVCAQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYYT
KYFDDSGDSGPRICEYALRQYSTWERLIDAWQRPILNDETLPDWYKCAIFNQLYFISDGG
TIWLKCESSLGKELSYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVS
LQYDFKDAIAAELNDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDW
KDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYELYSQDNKRKNSADEK
QQNRKSASMYINETNGKVYLMDAIGYLKAMYASCKAILERTIEYDKDNDGLIENTKMPDQ
TYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLEEKLWNGS
YYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNI
GAANGFIANAGEPTKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKT
LSQRIGMNFETPEALYGEKRYRSIGYMRPLSILSMQVALERRRAQRD
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacctttagcagcggaaaccaagccgctgagcaacggaaacgccaatggaaac
gcggtgggaatcgccgaatccgccagtgccgtcttccaggagaagatgaagctccagcag
gaggagcccaacgagatcgcggcggtgccgaagtacggactcaagctgaagttcgaccat
gtgtggccggaaaagaggatccagaatgtgcgggcctccatcaggcaaacgctgcccctg
gtgcccctcgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgccgg
gtatacatggactactactacatggagaatggcaagcagatctatggagtgcccatcggc
ggaattggaggtggtacaattggcaggggctatgccggcgagttctgccgtttccagatg
cgtcccggcatctacgagtacaatgtggtgcaggccaatcagtttatcgttaccatcaag
gatcccaaaggatgcaccatctttcagagcctcctctccaagtgcagcaccagggacaag
accagcgatccggatgccgatccggatggggaaagaactaaatgtcaactgcccaattgc
agcagtcgcgccaagcagccgctgagtgcctggcactcgaacatcgaggactcgcgctgc
agctacacgggtctctatccccgctcctggacggagtacgatctgtcccactatggagtc
cgtctgacctgtcgccaggtgtcgccggtaataccgcatgagtaccgggagtccagccag
ccctgtgccgtcttcgtttggagcgtggagaatgtctgcgaccaggagcgcaaggtgtcc
atcacgttcacgttcaagaacggcactgggaataagaaacaggatgcggagggcggagcc
gagtcgcagctaatcagcgagggcaacgccaagggagtctccatcaggcagaagatcgct
gatatgccctgcagctataatctggcatgtagggtccttcccgagatcagcatcacgcgg
tgcccccagttcgatcccgccggcaacggggagcagttgtgggcacagctcaaggagcat
ggccagcttagcgagcagcccacctcagaggcactaaaaaccaaagatataggcgtggct
gtctgtgcccaggtagccctgaagccaatggcatcccacgatctggagtttgtgctggcc
tgggacatgccaaagattcagttccccaggaagatgcagacccacacacgctactacacc
aagtacttcgatgacagcggtgattcgggtcccaggatctgcgagtatgcactcaggcag
tattccacctgggagcgcttgattgatgcctggcaaagacccattctcaatgatgaaacc
cttcccgactggtacaagtgtgccatcttcaatcaactttacttcatctcggatggcgga
accatctggctgaaatgcgaatcctcgctgggcaaggaactgtcatatgatgatccccgt
ttggcttatggccgtttcggttacctggaaggccacgaataccgcatgtacaacacctac
gatgtccatttctatgcatcgccggctctggcccacctgtggcccaatcttcaggtcagt
ctgcagtacgacttcaaggatgccattgccgcagaactaaacgatactcgtaaaatgctt
tacgatggcaaggtgatgccacgcaaggtcaagaactgtgtgccccacgatctcggagat
cccgatgaggaacccttcaccttgatcaactgctacaacattcacgatgtgaatgactgg
aaggatcttaatacgaagtttgtgctgcaggtgtatcgggactactatgtcctcaatgaa
ctggcccaggcccaggcggataatgccagtaagttcagctccatcgagtttatcgataag
gagagcctatatgagctgtacagccaggacaacaagcgcaagaattcagctgatgaaaag
caacaaaaccgtaaatctgcatcgatgtacatcaacgaaaccaatggaaaggtgtatcta
atggacgccattggctacttgaaggccatgtacgcatcgtgcaaggccatcttggagcga
accattgaatacgataaggacaacgacggtctgatcgagaacacaaagatgccggaccag
acctacgactcctgggtgatggacgggccgagtgcctactgctccggcctctggctggct
gctctgcaggccatgtccgccatggctacaatcctggatcagccgaacgattgcctgcgc
tatcaggatattctggagaagggcaagcgatcgctggaggagaagctctggaatggcagc
tactatcgctttgatctttcgcacagtcatcgggatacgatcatggccgatcagttatgt
ggtcattggtatctgaagtcctgcggcttcgattacgagatctatccgaaggagaacgtg
cgtacggcccttaagaggatctatgacaacaatgtgatgggctttcatgagggcaatatc
ggagcggctaatggcttcatagccaatgccggcgaacccaccaagccgggccacgtggac
aacagcaacatccaggcggaggaggtgtggccaggtgtggtttacgctctggctgccacc
atgatacaggagggcatgttcgaggaagccttccagaccgccggcggaatgtacaagacc
ctgtcccagcgcatcggcatgaacttcgagaccccggaagcgttgtatggcgagaagcgc
tatcgctccattggctatatgcgtccgctgagcattttgtccatgcaggtggcattggag
cgacggcgagcccaacgagattaa

DBGET integrated database retrieval system