KEGG   Drosophila simulans: Dsim_GD23968Help
Entry
Dsim_GD23968      CDS       T01065                                 

Gene name
Dsim_Adh
Definition
Alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:dsi01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsi00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dsi00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dsi00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dsi00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dsi00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:dsi00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 256 aa AA seqDB search
MAFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVT
FYPYDVTVPIAETTKLLKTIFAKLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAI
LDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYT
VNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDL
GTLEAIQWTKHWDSGI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttactttgaccaacaagaacgtgattttcgttgccggtctgggaggcattggt
ctggacaccagcaaggagctgctcaagcgcgacctgaagaacctggtgatcctcgaccgc
attgagaaccctgctgccattgccgagctgaaggcaatcaatccaaaggtgaccgtcacc
ttctacccctatgatgtgaccgtgcccattgccgagaccaccaagctgctgaagaccatc
ttcgccaagctgaagaccgtcgatgtcctgatcaacggagctggtatcctggacgatcac
cagatcgagcgcaccattgccgtcaactacactggcctggtcaacaccacgacggccatt
ctggacttctgggacaagcgcaagggtggtcccggtggtatcatctgcaacattggatcc
gtcactggtttcaatgccatctaccaggtgcccgtctactccggcaccaaggctgccgtg
gtcaacttcaccagctccctggcgaaactggcccccattaccggcgtgaccgcttacacc
gtgaaccccggcatcacccgcaccaccctggtgcacaagttcaactcctggctggatgtt
gagccccaggttgccgagaagctcctggctcatcccactcagccctcattggcctgcgcc
gagaacttcgtcaaggccatcgagctgaaccagaacggagccatctggaaactggacttg
ggcaccctggaggccatccagtggaccaagcactgggactccggcatctaa

DBGET integrated database retrieval system