KEGG   Drosophila simulans: Dsimw501_GD24072Help
Entry
Dsimw501_GD24072  CDS       T01065                                 

Gene name
Dsim_GD24072
Definition
(RefSeq) GD24072 gene product from transcript GD24072-RA
  KO
K08738  
cytochrome c
Organism
dsi  Drosophila simulans
Pathway
Sulfur metabolism
Metabolic pathways
Apoptosis - fly
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dsimw501_GD24072 (Dsim_GD24072)
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD24072 (Dsim_GD24072)
   04215 Apoptosis - multiple species
    Dsimw501_GD24072 (Dsim_GD24072)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2L
AA seq 105 aa AA seqDB search
MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGV
TWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggttctggtgatgcagagaacggcaagaagatctttgtgcagaagtgcgcccagtgc
cacacctacgaagtgggcggcaaacacaaggtgggcccaaatcttggcggagtcgtgggt
cgcaagtgcggcacagcagcgggatacaagtataccgatgccaatataaagaagggcgtt
acctggacagaggggaatttggacgagtacctcaaggacccgaagaaatacattcccgga
acaaagatggtgttcgcaggactcaaaaaggctgaggagcgggccgatttgattgccttc
ctcaagtcaaacaagtag

DBGET integrated database retrieval system