KEGG   Drosophila simulans: Dsim_GD24074Help
Entry
Dsim_GD24074      CDS       T01065                                 

Definition
GD24074 gene product from transcript GD24074-RA
Orthology
K08738  
cytochrome c
Organism
dsi  Drosophila simulans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dsim_GD24074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttcctgctggtgatgttgagaagggcaagaagctgttcgtgcagcgctgcgcc
cagtgccacaccgttgaggctggtggcaagcacaaggttggacccaatctgcatggtctg
atcggtcgcaagaccggacaggcggccggtttcgcgtacacggacgccaacaaggccaag
ggcatcacctggaacgaggacaccctgttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaacgagcgcggcgatctgatc
gcctacctgaagtcggccaccaagtaa

DBGET integrated database retrieval system